KEGG   Mycobacterium tuberculosis H37Rv: Rv2496cHelp
Entry
Rv2496c           CDS       T00015                                 

Gene name
bkdB
Definition
(RefSeq) 3-methyl-2-oxobutanoate dehydrogenase subunit beta
  KO
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv2496c (bkdB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2496c (bkdB)
   00020 Citrate cycle (TCA cycle)
    Rv2496c (bkdB)
   00620 Pyruvate metabolism
    Rv2496c (bkdB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Rv2496c (bkdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2809936..2810982)
Genome map
AA seq 348 aa AA seqDB search
MTQIADRPARPDETLAVAVSDITQSLTMVQAINRALYDAMAADERVLVFGEDVAVEGGVF
RVTEGLADTFGADRCFDTPLAESAIIGIAVGLALRGFVPVPEIQFDGFSYPAFDQVVSHL
AKYRTRTRGEVDMPVTVRIPSFGGIGAAEHHSDSTESYWVHTAGLKVVVPSTPGDAYWLL
RHAIACPDPVMYLEPKRRYHGRGMVDTSRPEPPIGHAMVRRSGTDVTVVTYGNLVSTALS
SADTAEQQHDWSLEVIDLRSLAPLDFDTIAASIQRTGRCVVMHEGPRSLGYGAGLAARIQ
EEMFYQLEAPVLRACGFDTPYPPARLEKLWLPGPDRLLDCVERVLRQP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaatcgcagaccgtccggccaggccggatgagacgcttgcggtagcggtgagc
gacatcacgcagtcgttgaccatggtccaggcgatcaaccgcgccctgtacgacgcgatg
gccgccgacgagcgggtattggtgtttggcgaggatgtcgcggtcgagggtggggtgttt
cgggtgaccgagggactggccgatacgttcggtgcagaccggtgcttcgacacgccactg
gcggagtccgcgatcatcggaatagccgtcgggttggcactacgtggctttgtgccggtg
ccagaaatccagttcgacggcttttcctatccggctttcgaccaagtggtgagccatctg
gccaagtaccggactcgcacccgcggtgaggtggacatgccggtgaccgtccggatcccc
tcgtttggcggtatcggtgcggccgaacatcattcggactccacggagtcctactgggtg
cacaccgcgggcctcaaggtggtggtgccgtcgacacccggtgacgcttactggctgctg
cggcacgctatcgcctgcccggaccccgtgatgtatctggagcccaaacgccgctaccac
ggccgcgggatggtcgacactagccggccggaaccgccgatcgggcacgcgatggtgcgc
cggtccggcaccgatgtgaccgtggtaacgtacggaaacctggtgagcaccgccctgtct
agcgcggatactgcagagcagcaacatgattggagtctggaggttatcgatctgcggtcg
ttggcgccgctggacttcgacaccattgctgcgtcgatccagcgcaccgggcgttgcgtg
gtgatgcacgaagggccgcgcagcctcggctatggtgccggtctggccgcgcgcatccag
gaagagatgttctaccaattggaggctccggtgttgcgtgcctgcggttttgacacaccc
tacccgcctgcgcggttggaaaaattgtggttacccggccccgaccggctgttggactgc
gtcgaacgtgtgctgcgtcagccatga

DBGET integrated database retrieval system