KEGG   Mycobacterium tuberculosis H37Rv: Rv2501cHelp
Entry
Rv2501c           CDS       T00015                                 

Gene name
accA1
Definition
(RefSeq) acetyl/propionyl-CoA carboxylase subuit alpha
  KO
K11263  
acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid biosynthesis
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv2501c (accA1)
   01212 Fatty acid metabolism
    Rv2501c (accA1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv2501c (accA1)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2501c (accA1)
   00640 Propanoate metabolism
    Rv2501c (accA1)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv2501c (accA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv2501c (accA1)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Rv2501c (accA1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Rv2501c (accA1)
    6.4.1.3  propionyl-CoA carboxylase
     Rv2501c (accA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2814916..2816880)
Genome map
AA seq 654 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLRRLGIRSVAVYSDPDVDARHVLEADAAVRLGPAPARESY
LDIGKVLDAAARTGAQAIHPGYGFLAENADFAAACERARVVFLGPPARAIEVMGDKIAAK
NAVAAFDVPVVPGVARAGLTDDALVTAAAEVGYPVLIKPSAGGGGKGMRLVQDPARLPEA
LVSARREAMSSFGDDTLFLERFVLRPRHIEVQVLADAHGNVVHLGERECSLQRRHQKVIE
EAPSPLLDPQTRERIGVAACNTARCVDYVGAGTVEFIVSAQRPDEFFFMEMNTRLQVEHP
VTEAITGLDLVEWQLRVGAGEKLGFAQNDIELRGHAIEARVYAEDPAREFLPTGGRVLAV
FEPAGPGVRVDSSLLGGTVVGSDYDPLLTKVIAHGADREEALDRLDQALARTAVLGVQTN
VEFLRFLLADERVRVGDLDTAVLDERSADFTARPAPDDVLAAGGLYRQWALARRAQGDLW
AAPSGWRGGGHMAPVRTAMRTPLRSETVSVWGPPESAQVQVGDGEIDCASVQVTREQMSV
TISGLRRDYRWAEADRHLWIADERGTWHLREAEEHKIHRAVGARPAEVVSPMPGSVIAVQ
VESGSQISAGDVVVVVEAMKMEHSLEAPVSGRVQVLVSVGDQVKVEQVLARIKD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaccgtactagtggccaaccgcggtgagatcgcggttcgggtgattcggacg
ctgcgccggctaggcatccggtcggtcgcggtctacagcgaccccgacgtcgatgcccgc
cacgtcttggaggcggacgctgcggtgcggctggggcccgccccagcacgcgaaagctac
ctcgatatcggcaaggtgctcgatgctgcggcgcgcaccggagcccaggcgatccatccg
ggctacgggtttcttgccgagaatgccgatttcgctgcggcgtgtgaacgcgcccgggtg
gtgttcctgggtccgccggcgcgcgcgatcgaggtgatgggcgacaagatcgccgccaag
aacgcggtcgccgctttcgatgttccggtggtgcccggtgtggcgcgcgccgggctgacg
gacgacgcgctggtcaccgctgccgctgaggtgggctatccggtgctgatcaaaccgtcg
gccggcggcggcggcaaagggatgcggttagtgcaagatccggcgcggctgcctgaggcg
ctggtgagtgcccggcgcgaagccatgtcttcgttcggggacgatacgctattcctggag
cggtttgtgttgcggcccaggcacatcgaagtgcaggtgcttgccgacgctcacggcaac
gtggtgcatctgggtgagcgtgagtgcagcctccagcggcgccaccagaaggttatcgag
gaggcgccgtcgccactgcttgacccgcagacccgcgagcgcatcggggtcgcggcctgc
aacaccgcccgctgcgtggactacgtcggcgccggcacggtggagttcatcgtctccgcg
cagcgccccgacgagttctttttcatggagatgaatacccggctgcaggtggaacacccg
gtcaccgaggcgattactggattggacctggtcgagtggcagttgcgggtgggtgcgggc
gaaaagttgggcttcgcccaaaacgacatcgagctgcgtgggcacgcgatcgaggctcgg
gtgtatgcggaggatcccgcgcgggaattcctgcccaccggcggccgggtgctggcggtg
ttcgaacccgccggccccggggtgcgggtggattcgtcactgctaggcggcacggtggtc
ggcagtgattacgacccgttgctcaccaaggtgattgcgcacggggccgatcgcgaggaa
gcgctggatcggctggaccaggcgctggcgcggactgcggtgctgggagtgcagaccaat
gtcgagttccttcgctttctgctcgccgacgagcgggtgcgggtcggggatttggacacc
gctgtactggacgagcgatcggccgatttcactgcgcggccggcgcctgacgacgtgcta
gctgccggcggcctctaccgccagtgggccctggcccggcgcgcacagggcgacctgtgg
gccgcgccgtccggatggcgcggcgggggccatatggcaccggtccgcaccgccatgcgc
accccgctgcgcagcgagaccgtttcggtgtgggggccacccgagtcggcgcaggttcag
gttggcgatggtgagatcgattgtgcgagcgtgcaggtcacccgagaacagatgagcgtg
acgataagcgggctgcgccgggattatcggtgggcagaggctgaccggcacctgtggatc
gccgacgagcgcgggacttggcacctgcgcgaggccgaggagcacaagattcaccgcgcc
gtgggtgcgcggccggcggaggtcgtcagccctatgcctggcagcgtgatcgccgtgcag
gtcgagtccggctcccagatctctgcgggtgatgtggtggtggtggtggaagcgatgaag
atggagcactcgctggaggcgccggtttcgggacgggtacaggtgttggtgtccgttggc
gatcaggtgaaagtcgaacaggtactggcgaggatcaaggactag

DBGET integrated database retrieval system