KEGG   Mycobacterium tuberculosis H37Rv: Rv2504cHelp
Entry
Rv2504c           CDS       T00015                                 

Gene name
scoA
Definition
(RefSeq) succinyl-CoA:3-ketoacid-CoA transferase subunit A
  KO
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rv2504c (scoA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rv2504c (scoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv2504c (scoA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Rv2504c (scoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2819124..2819870)
Genome map
AA seq 248 aa AA seqDB search
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVG
LGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTP
AGVGTQVADGGLPWRYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRH
GNLMYRHAAANFNPECASAGRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKK
IERETVRQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccaccgccgcggaggcggtcgcagacatagccaacgggtcgtcg
cttgcggttggtggattcgggctttgcggcatccccgaagcactgatcgcagcgttggtg
gatagcggtgtcaccgacctggaaacagtctcgaacaactgcggaatcgacggtgttggt
ctgggactattgttgcaacacaagcgaattcgccggacagtctcctcctacgtgggggag
aacaaggagttcgcccgccagttcctcgcgggcgagctcgaggtggaactgaccccgcag
ggcacgctggccgagcggttgcgggccggagggatgggcataccggccttctatacaccg
gcaggggtcggtacccaggtcgccgacggcgggttgccgtggcgctacgacgcctcgggc
ggggtggcggtggtgtcgccggccaaggagactcgggagttcgatggtgtcacctatgtc
ctcgagcgggggatccggaccgacttcgcactggtgcatgcctggcagggggaccggcac
ggcaacctgatgtaccgccacgccgcggccaacttcaacccggagtgcgcatccgcaggc
aggatcacgatcgccgaggtcgagcacttggtcgagccgggtgagatcgaccctgccacc
gtacacaccccgggcgtgtttgtgcaccgggtggttcatgtgcccaaccccgccaagaag
atcgagagggagacggtgcggcaatga

DBGET integrated database retrieval system