KEGG   Mycobacterium tuberculosis H37Rv: Rv2504cHelp
Entry
Rv2504c           CDS       T00015                                 

Gene name
scoA
Definition
(RefSeq) succinyl-CoA:3-ketoacid-CoA transferase subunit A
  KO
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
   00650 Butanoate metabolism
    Rv2504c (scoA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Rv2504c (scoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv2504c (scoA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Rv2504c (scoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2819124..2819870)
Genome map
AA seq 248 aa AA seqDB search
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVG
LGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTP
AGVGTQVADGGLPWRYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRH
GNLMYRHAAANFNPECASAGRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKK
IERETVRQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccaccgccgcggaggcggtcgcagacatagccaacgggtcgtcg
cttgcggttggtggattcgggctttgcggcatccccgaagcactgatcgcagcgttggtg
gatagcggtgtcaccgacctggaaacagtctcgaacaactgcggaatcgacggtgttggt
ctgggactattgttgcaacacaagcgaattcgccggacagtctcctcctacgtgggggag
aacaaggagttcgcccgccagttcctcgcgggcgagctcgaggtggaactgaccccgcag
ggcacgctggccgagcggttgcgggccggagggatgggcataccggccttctatacaccg
gcaggggtcggtacccaggtcgccgacggcgggttgccgtggcgctacgacgcctcgggc
ggggtggcggtggtgtcgccggccaaggagactcgggagttcgatggtgtcacctatgtc
ctcgagcgggggatccggaccgacttcgcactggtgcatgcctggcagggggaccggcac
ggcaacctgatgtaccgccacgccgcggccaacttcaacccggagtgcgcatccgcaggc
aggatcacgatcgccgaggtcgagcacttggtcgagccgggtgagatcgaccctgccacc
gtacacaccccgggcgtgtttgtgcaccgggtggttcatgtgcccaaccccgccaagaag
atcgagagggagacggtgcggcaatga

DBGET integrated database retrieval system