KEGG   Mycobacterium tuberculosis H37Rv: Rv2523cHelp
Entry
Rv2523c           CDS       T00015                                 

Gene name
acpS
Definition
(RefSeq) holo-ACP synthase
  KO
K00997  
holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv2523c (acpS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     Rv2523c (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2839538..2839930)
Genome map
AA seq 130 aa AA seqDB search
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAV
IKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDT
AAAVAILEAP
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgtcggtgtggggatcgacctggtctccattcccgatttcgccgagcaggtc
gaccagcccggaacggtgttcgccgagaccttcaccccgggtgagcgccgggacgcctcg
gacaagagttcgtcggcggcccggcacctggcggcccgctgggccgcgaaggaggcggtg
atcaaggcctggtccggatcgcggttcgcgcagcggccggtgttgccggaggacatccac
cgcgatatcgaggtggtcaccgatatgtggggcaggccgcgggtcaggctgaccggggcc
atcgctgagtatttggccgacgtgacgatccatgtgtcgctgacccacgaaggggatacc
gcggccgcggtcgccatcctggaggccccgtga

DBGET integrated database retrieval system