KEGG   Mycobacterium tuberculosis H37Rv: Rv2538cHelp
Entry
Rv2538c           CDS       T00015                                 

Gene name
aroB
Definition
(RefSeq) 3-dehydroquinate synthase
  KO
K01735  
3-dehydroquinate synthase [EC:4.2.3.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2538c (aroB)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2538c (aroB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Rv2538c (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2861588..2862676)
Genome map
AA seq 362 aa AA seqDB search
MTDIGAPVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLA
GKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATW
LRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEM
ICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESE
LREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSS
LGLPVSYDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVC
AP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcggcgcacccgtgaccgtgcaggtggccgtcgatccgccatacccggtg
gtcatcggtaccggcctgctcgacgagctggaagacctgctggccgaccggcacaaggtc
gccgtcgtgcatcagcccggactagccgagaccgcggaagagatccgaaagcgcttggcc
ggcaagggcgtcgacgcgcaccgcatcgagatccccgacgccgaggccggcaaggacctg
cccgtcgtgggattcatctgggaggtgttgggccgcatcggaatcggccgcaaagacgcc
ctggtcagcctcggcggcggggccgccaccgacgtcgccgggttcgcggcggccacctgg
ctgcgcggcgtctcgattgtgcacctgcccaccacactgctgggcatggtcgatgcggcc
gtcggcggcaagaccggcatcaacaccgacgccggcaagaacctggtcggggcgtttcat
cagccgttggcggtcctggtggacctggcgacgctgcaaaccttgccacgcgacgaaatg
atctgcggcatggccgaagtggtcaaggccggcttcatcgccgacccggtgatcctggat
ctcatcgaagctgacccgcaggccgcactcgacccggccggcgacgtgctgcccgagctg
atccggcgcgcgatcaccgtcaaggccgaggtggtcgccgccgacgaaaaggaatccgag
ctgcgcgaaatcctcaactacggccacacattaggccacgcgatcgagcgccgggaacgc
taccggtggcgccacggcgccgccgtgtcggtggggctggtgttcgcggccgagctggcc
aggcttgccgggcggctcgacgacgcgaccgcgcagcgccaccgcaccatcctgtcctcg
ttgggattgccggtcagctacgacccggacgcgctgccccagctgctggaaatcatggcc
ggcgacaagaagactcgggcgggtgtgttgcggttcgtggtgctcgacggattggccaag
ccgggccgaatggtgggaccggaccccggtctgctggtaaccgcctacgccggagtttgc
gccccatga

DBGET integrated database retrieval system