KEGG   Mycobacterium tuberculosis H37Rv: Rv2539cHelp
Entry
Rv2539c           CDS       T00015                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase
  KO
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2539c (aroK)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2539c (aroK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Rv2539c (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2862673..2863203)
Genome map
AA seq 176 aa AA seqDB search
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRI
EEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLL
AGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaagcggttctcgtcggcctgccgggctccggcaagtccaccatcgggcgc
cggctggccaaggcgctcggggtcggcctgctcgacaccgacgtcgcgatcgagcagcgg
accggacgcagcatcgccgacatcttcgccaccgacggggagcaggagttccgacgtatc
gaggaggacgtggtgcgcgcggcactggccgaccacgacggtgtgctgtcgctcggcggc
ggcgcggtgaccagccccggtgtgcgcgcggcgctggccggccacaccgtcgtctacctg
gagatcagcgccgccgagggcgtgcgccgcaccggcggcaacaccgtgcgcccactgctg
gccggccccgaccgcgccgaaaaataccgcgcgctgatggccaagcgggcaccgctgtac
cggcgcgtcgcgaccatgcgagtggacaccaatcgccgcaaccccggggcggtggtccgc
catatcctgtcgcggctgcaggttcccagccccagcgaggcggccacatga

DBGET integrated database retrieval system