KEGG   Mycobacterium tuberculosis H37Rv: Rv2540cHelp
Entry
Rv2540c           CDS       T00015                                 

Gene name
aroF
Definition
(RefSeq) chorismate synthase
  KO
K01736  
chorismate synthase [EC:4.2.3.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2540c (aroF)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2540c (aroF)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     Rv2540c (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2863207..2864412)
Genome map
AA seq 401 aa AA seqDB search
MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVL
SGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAG
MLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPP
PRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSG
DHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEG
GMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVAL
VLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgctggatcaccgcgggggagtcacacggccgcgccttggtggccgtggtcgaa
ggcatggtcgccggcgtgcacgtcacctcggccgacatcgccgaccagctggcccgacgc
cggctgggctacggccgcggcgcacggatgacgttcgagcgcgacgcggtgaccgtgctg
tccgggatacgccacggcagcaccctgggcgggcccatcgccatcgagatcggcaacacc
gaatggcccaaatgggagaccgtgatggccgccgacccggtcgaccccgccgagctggcc
gacgtcgcacgcaacgccccgctcacccggccgcggccgggccacgccgactacgcgggc
atgctcaaatacggcttcgacgacgcgcggccggtgctggagcgggccagcgcccgcgag
accgccgcccgggtcgcggcgggcacggtcgcacgggcattcctgaggcaggcgctgggt
gtcgaggtgctctcccacgtcatctcgatcggcgcgtcggcaccctacgagggtccgccg
ccgcgggccgaggacctacccgccatcgacgccagcccggtacgcgcctacgacaaggcc
gccgaggcggacatgatcgcccaaatcgaggcggccaagaaagacggcgacaccctcggc
ggcgtggtggaggcggtcgcgctgggcctgccggtggggctggggtcgttcaccagcggc
gaccatcggctcgacagccagctggccgccgccgtcatgggcatccaggcgatcaagggc
gtggagatcggcgacggattccagaccgcgcgccgccgcggcagccgcgcccacgacgag
atgtaccccgggcccgacggcgtcgtccgctccaccaaccgggccggggggctggaaggc
gggatgaccaacgggcagccgctgcgggtgcgtgcggcgatgaagccgatctccacggtg
ccgcgcgcgctggccaccgtcgacctggcgaccggcgatgaggccgtcgccatccatcag
cgctcggatgtgtgcgcggtgccggcggccggggtcgtggtggagaccatggtggcgttg
gtgctggcccgggcggcgctggaaaaattcggcggggattcgctggccgaaacccagcgc
aacatcgccgcctaccagcgcagcgtcgccgaccgcgaagcaccggccgcgcgggtctcc
ggttaa

DBGET integrated database retrieval system