KEGG   Mycobacterium tuberculosis H37Rv: Rv2540cHelp
Entry
Rv2540c           CDS       T00015                                 

Gene name
aroF
Definition
(RefSeq) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2540c (aroF)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     Rv2540c (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-GeneID: 887379
NCBI-ProteinID: NP_217056
TubercuList: Rv2540c
UniProt: P9WPY1 I6YDP0
Structure
PDB: 

Jmol
Position
complement(2863207..2864412)
Genome map
AA seq 401 aa AA seqDB search
MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVL
SGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAG
MLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPP
PRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSG
DHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEG
GMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVAL
VLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgctggatcaccgcgggggagtcacacggccgcgccttggtggccgtggtcgaa
ggcatggtcgccggcgtgcacgtcacctcggccgacatcgccgaccagctggcccgacgc
cggctgggctacggccgcggcgcacggatgacgttcgagcgcgacgcggtgaccgtgctg
tccgggatacgccacggcagcaccctgggcgggcccatcgccatcgagatcggcaacacc
gaatggcccaaatgggagaccgtgatggccgccgacccggtcgaccccgccgagctggcc
gacgtcgcacgcaacgccccgctcacccggccgcggccgggccacgccgactacgcgggc
atgctcaaatacggcttcgacgacgcgcggccggtgctggagcgggccagcgcccgcgag
accgccgcccgggtcgcggcgggcacggtcgcacgggcattcctgaggcaggcgctgggt
gtcgaggtgctctcccacgtcatctcgatcggcgcgtcggcaccctacgagggtccgccg
ccgcgggccgaggacctacccgccatcgacgccagcccggtacgcgcctacgacaaggcc
gccgaggcggacatgatcgcccaaatcgaggcggccaagaaagacggcgacaccctcggc
ggcgtggtggaggcggtcgcgctgggcctgccggtggggctggggtcgttcaccagcggc
gaccatcggctcgacagccagctggccgccgccgtcatgggcatccaggcgatcaagggc
gtggagatcggcgacggattccagaccgcgcgccgccgcggcagccgcgcccacgacgag
atgtaccccgggcccgacggcgtcgtccgctccaccaaccgggccggggggctggaaggc
gggatgaccaacgggcagccgctgcgggtgcgtgcggcgatgaagccgatctccacggtg
ccgcgcgcgctggccaccgtcgacctggcgaccggcgatgaggccgtcgccatccatcag
cgctcggatgtgtgcgcggtgccggcggccggggtcgtggtggagaccatggtggcgttg
gtgctggcccgggcggcgctggaaaaattcggcggggattcgctggccgaaacccagcgc
aacatcgccgcctaccagcgcagcgtcgccgaccgcgaagcaccggccgcgcgggtctcc
ggttaa

DBGET integrated database retrieval system