KEGG   Mycobacterium tuberculosis H37Rv: Rv2552cHelp
Entry
Rv2552c           CDS       T00015                                 

Gene name
aroE
Definition
(RefSeq) shikimate 5-dehydrogenase
  KO
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2552c (aroE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     Rv2552c (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2871206..2872015)
Genome map
AA seq 269 aa AA seqDB search
MSEGPKKAGVLGSPIAHSRSPQLHLAAYRALGLHDWTYERIECGAAELPVVVGGFGPEWV
GVSVTMPGKFAALRFADERTARADLVGSANTLVRTPHGWRADNTDIDGVAGALGAAAGHA
LVLGSGGTAPAAVVGLAELGVTDITVVARNSDKAARLVDLGTRVGVATRFCAFDSGGLAD
AVAAAEVLVSTIPAEVAAGYAGTLAAIPVLLDAIYDPWPTPLAAAVGSAGGRVISGLQML
LHQAFAQVEQFTGLPAPREAMTCALAALD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggtcccaaaaaagccggcgtgcttggttcgccgatcgcgcattcccgctcc
ccgcagctgcacctggccgcctaccgggcgttggggctgcacgactggacctatgagcgc
atcgaatgcggtgcggccgagttgcccgtcgtggtcggtggtttcggaccggagtgggtc
ggtgtttcggtgaccatgccgggcaagttcgccgccctgcggttcgccgacgagcgcacc
gcacgcgcggaccttgtcggttcggccaacaccctggttcggacgccgcatggctggcgg
gccgacaacaccgacatcgacggggtggccggggcgttgggggcggctgctggacacgcg
ctggtgctggggtccggggggaccgcaccggcggccgtggtggggctggccgaactcggg
gtcaccgacatcaccgtggtggcgcgcaactcggacaaggcggcccggctggtggacctg
ggcacacgggtcggcgtggcgacccggttctgcgcgttcgacagcggtgggttggccgat
gcggtggccgccgcggaagtgctggtcagcaccattccagcggaggtggccgcggggtat
gccggcaccttggccgcgatcccggtgctgttggacgccatctacgatccgtggcccaca
ccgctggccgccgcggtcggatcggcgggcgggcgggtgatcagcgggctgcagatgttg
ctgcatcaggcgttcgcgcaggtggagcagttcaccgggctacccgccccccgcgaagcg
atgacttgcgcgctggccgcgttggactag

DBGET integrated database retrieval system