KEGG   Mycobacterium tuberculosis H37Rv: Rv2573Help
Entry
Rv2573            CDS       T00015                                 

Definition
(RefSeq) 2-dehydropantoate 2-reductase
  KO
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv2573
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     Rv2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2898043..2898783
Genome map
AA seq 246 aa AA seqDB search
MVPGPVHTSPREVAGPVDVLILAVKATQNDAARPWLTRLCDERTVVAVLQNGVEQVEQVQ
PHCPSSAVVPAIVWCSAETQPQGWVRLRGEAALVVPTGPAAEQFAGLLRGAGATVDCDPD
FTTAAWRKLLVNALAGFMVLSGRRSAMFRRDDVAALSRRYVAECLAVARAEGARLDDDVV
DEVVRLVRSAPQDMGTSMLADRAAHRPLEWDLRNGVIVRKARAHGLATPISDVLVPLLAA
ASDGPG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcccggtccggtgcacaccagtcctcgggaggttgccggcccggtcgatgtgctg
atcctggcggtcaaggccactcagaacgacgccgcacgtccctggctgacccgcctgtgc
gacgagcgcaccgtggtggccgtgctgcaaaacggtgtcgaacaggtcgagcaggtccag
ccgcattgtccgtcctcggccgtggttcccgcgatcgtgtggtgttcggccgagacccag
ccgcaagggtgggtgcgcttgcgcggtgaagccgcactggtcgttcccaccgggcccgcg
gccgagcagttcgccgggctgctgcgcggtgccggcgccacggtggactgcgaccccgac
ttcaccacggcggcctggcgcaaactactggtcaacgcgctggcgggatttatggtgctg
tccggacggcggtcggcaatgttccgccgcgacgacgtcgcggcattgtcgcgccgctat
gtcgccgaatgcctggcggtggcgcgcgctgagggtgcccgactcgatgacgacgtcgtc
gacgaagtggtccgcctcgtccggtcggccccgcaggacatgggcacctcgatgctggcc
gaccgggcagcccaccggccactggaatgggatttgcgcaatggggtgatcgtccgcaag
gcccgcgcccacggcctggccaccccgatcagcgacgtgctggtgccgctgctggcggct
gccagcgacggtcccggatag

DBGET integrated database retrieval system