KEGG   Mycobacterium tuberculosis H37Rv: Rv2584cHelp
Entry
Rv2584c           CDS       T00015                                 

Gene name
apt
Definition
(RefSeq) adenine phosphoribosyltransferase
  KO
K00759  
adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv2584c (apt)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     Rv2584c (apt)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv2584c (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2910229..2910900)
Genome map
AA seq 223 aa AA seqDB search
MCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASL
TRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVAT
RLEVGVLAVRKGGKLPRPVLSEEYYRAYGAATLEILAEGIEVAGRRVVIIDDVLATGGTI
GATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccatggcggtacatgggctggtgactacgtgttgaacgtgatcgcgacggggctc
tccttaaaggcacgggggaagcgccgccggcagcgttgggtcgacgacgggcgggtattg
gcgctcggtgagtcccgccggagctcagccatatctgtggccgacgtggttgcgtcgctg
acccgggatgtggccgactttccggttcccggcgtcgagttcaaggacctcaccccgcta
ttcgccgaccgaagaggattggccgcggtaaccgaagcgctggccgatcgggcgtccgga
gctgacctggtggccggcgtcgacgcccgcgggtttctggtggcagccgcggtcgccacc
cggctcgaagtgggtgtgctggccgttcgcaagggcggcaagctgccccggccggtgctc
agcgaggagtactacagggcgtacggcgccgccactctggagattctcgctgagggcatc
gaggttgcgggccgccgtgtcgtgatcattgacgacgtgttagcaaccggcggcaccatc
ggcgcgacgcgacgcctgcttgagcgcggtggcgccaacgtggccggggcggccgtagtg
gtggaacttgcggggttgagcggtcgcgcggcgctcgcaccgctgccggtgcacagcctg
agccgcctgtga

DBGET integrated database retrieval system