KEGG   Mycobacterium tuberculosis H37Rv: Rv2589Help
Entry
Rv2589            CDS       T00015                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv2589 (gabT)
   00650 Butanoate metabolism
    Rv2589 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv2589 (gabT)
   00280 Valine, leucine and isoleucine degradation
    Rv2589 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv2589 (gabT)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rv2589 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Rv2589 (gabT)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class III
   Rv2589 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2916360..2917709
Genome map
AA seq 449 aa AA seqDB search
MASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVAVAEQLNRITPGSGPKRS
VLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKQLATNGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVP
AEGFLPALLDWCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIERARQIERLVTDR
LTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTERLATAAHAAGVIILTCGMFGN
IIRLLPPLTIGDELLSEGLDIVCAILADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctgcagcagagtcggcgcctggtcaccgaaatccccggtcccgcatcgcag
gcactgactcaccgccgggcggcggcggtgtccagcggtgttggggtcaccctgccggtg
ttcgtagcccgcgccggcggcggcatcgtggaagacgtggacggtaaccggctcatcgac
ctgggttcgggcatcgcagtgacgacgatcggcaactcgtcgccacgcgtggtggatgcg
gtgcgcacgcaggtggccgaatttacccacacctgcttcatggtgacgccatacgagggg
tacgtggccgtcgccgagcaactcaaccggattaccccaggttcgggccccaagcgctcg
gtgttgttcaattccggcgccgaggcagtcgagaacgccgtcaagatcgcacgctcctac
accggcaagcccgcggtggtggcgttcgaccacgcctaccacggtcgcaccaacctaacg
atggcgctgaccgccaagtcgatgccctacaagagcggcttcggtccgttcgcgccggag
atctaccgagcgccattgtcttacccctatcgggacggcctcctcgataagcaactggct
accaatggtgagctagccgcggcccgagccatcggcgtcatcgacaagcaggtaggcgcg
aacaacctggccgccctcgtcatcgaaccgatccagggcgaaggcggtttcatcgttccg
gccgaagggttcctacctgccctcctcgattggtgccgcaagaaccatgtggtgttcatc
gccgacgaggtgcaaaccggctttgcccgtaccggggcgatgttcgcctgcgagcacgag
ggccccgacggtctagagcccgacctgatctgcacggccaaaggcatcgccgatggattg
ccgctgtcggcggtcaccggccgcgccgagatcatgaacgccccgcacgtgggcggcctg
ggcggcacgttcggcggcaacccggtggcctgtgcggccgcgctggccaccatcgcaacc
atcgaaagcgacgggctgatcgagcgggcccgccagatcgaacgcctggtgaccgaccgg
ttgacgacgctgcaggccgtcgacgaccggatcggcgacgtgcgtggtcgcggcgccatg
atcgccgtagagctggtcaaatccggaaccaccgagcccgacgccgggctgaccgagcgg
ctggcgaccgcggcccacgccgccggcgtcatcattttgacctgcggcatgttcggcaac
atcatccggctactgccgccgctgaccatcggcgacgagctgctgagtgaggggctggac
atcgtgtgcgcgatcttggccgacctctga

DBGET integrated database retrieval system