KEGG   Mycobacterium tuberculosis H37Rv: Rv2601Help
Entry
Rv2601            CDS       T00015                                 

Gene name
speE
Definition
(RefSeq) spermidine synthase
  KO
K00797  
spermidine synthase [EC:2.5.1.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2601 (speE)
   00330 Arginine and proline metabolism
    Rv2601 (speE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv2601 (speE)
   00480 Glutathione metabolism
    Rv2601 (speE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Rv2601 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2928388..2929959
Genome map
AA seq 523 aa AA seqDB search
MTSTRQAGEATEASVRWRAVLLAAVAACAACGLVYELALLTLAASLNGGGIVATSLIVAG
YIAALGAGALLIKPLLAHAAIAFIAVEAVLGIIGGLSAAALYAAFAFLDELDGSTLVLAV
GTALIGGLVGAEVPLLMTLLQRGRVAGAADAGRTLANLNAADYLGALVGGLAWPFLLLPQ
LGMIRGAAVTGIVNLAAAGVVSIFLLRHVVSGRQLVTALCALAAALGLIATLLVHSHDIE
TTGRQQLYADPIIAYRHSAYQEIVVTRRGDDLRLYLDGGLQFCTRDEYRYTESLVYPAVS
DGARSVLVLGGGDGLAARELLRQPGIEQIVQVELDPAVIELARTTLRDVNAGSLDNPRVH
VVIDDAMSWLRGAAVPPAGFDAVIVDLRDPDTPVLGRLYSTEFYALAARALAPGGLMVVQ
AGSPYSTPTAFWRIISTIRSAGYAVTPYHVHVPTFGDWGFALARLTDIAPTPAVPSTAPA
LRFLDQQVLEAATVFSGDIRPRTLDPSTLDNPHIVEDMRHGWD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccacccggcaggcgggcgaagccaccgaagcttcggtacggtggcgggccgtg
ctgctggccgcggtcgcggcgtgcgcggcctgcggtctcgtttacgagctcgcgctgctg
acactggcggcgagcctgaacggcggcgggatcgtggccacctccctgatcgtcgcgggc
tacatagccgcgctgggagcaggcgccttgctgatcaagccgctacttgcacacgcggcc
atcgcgttcatcgccgtggaggcggtgctgggcatcatcggcggattgtccgcggcggcg
ctgtatgcggcgttcgcgttcctggacgagctcgacgggtcgacgctggttcttgcggtg
ggcaccgccctgatcggcgggctggtcggcgccgaggtgccgctgctgatgacgctgttg
cagcgcggccgcgtggcaggggccgccgatgccggacgcaccctggccaacctcaacgcg
gccgactatctgggcgcgttggtcggcgggctggcctggccattcctgctgctgccgcag
ttagggatgatccgcggtgcggcggtcaccggcatcgtcaatctggcggccgccggggtt
gtgtcgatcttcctgctgcgccacgtcgtgtccggccggcaactggtgaccgccttatgc
gcgctcgccgcggcgctcgggctgatcgccacactgctggtgcattcccacgacattgag
accaccggccgccaacagctctacgccgacccgatcatcgcctaccgacacagcgcctac
caggaaatcgtggtcacccgccgcggcgatgacctgcgcctctacctggacggaggtttg
cagttctgcacccgcgacgaataccgctacaccgaaagcctggtctacccggcagtctcc
gatggcgcgcgttcggtgctggtgctcggtggcggcgacggactggcagcccgcgaactg
ctgcgccaacccggcatcgagcagatcgtgcaggtggaactcgaccccgcggtcatcgaa
ctggcgcgcaccaccctgcgcgacgtcaacgccggttcgctggacaacccgcgcgtacac
gtcgtgatcgacgacgccatgagctggctacgcggcgccgcggtccccccggctggcttc
gacgcagtgatcgtcgaccttcgcgaccccgatactcccgtgctgggtcggctgtattcc
accgagttctacgcactcgccgcccgcgcgctcgcgcccggcgggctcatggtcgtgcag
gcaggcagcccgtattcgaccccgactgcgttctggcgcatcatctccacgatccggtcc
gccgggtatgccgtcacgccctaccacgtgcacgtgcccaccttcggcgactggggattc
gccctggcacgccttacagacatcgcgcccacccccgctgtgccgagcactgcccctgca
ctgcgcttcctggaccaacaggtgctcgaggccgcgaccgtgttttccggcgacatccgg
ccccgcacgttggacccgtcgaccctggacaatccgcacattgttgaggacatgcggcac
ggctgggactag

DBGET integrated database retrieval system