KEGG   Mycobacterium tuberculosis H37Rv: Rv2610cHelp
Entry
Rv2610c           CDS       T00015                                 

Gene name
pimA
Definition
(RefSeq) alpha-(1-2)-phosphatidylinositol mannosyltransferase
  KO
K08256  
phosphatidyl-myo-inositol alpha-mannosyltransferase [EC:2.4.1.345]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.345  phosphatidyl-myo-inositol alpha-mannosyltransferase
     Rv2610c (pimA)
Glycosyltransferases [BR:mtu01003]
 GPI-anchor biosynthesis
  Phosphatidylinositol mannoside
   Rv2610c (pimA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2937865..2939001)
Genome map
AA seq 378 aa AA seqDB search
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPI
PYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTS
TTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAAR
LDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGR
LAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRR
VLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQI
MRVYETVAGSGAKVQVAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggcatgatttgtccgtactcgttcgacgtcccgggcggggtgcagtcgcat
gtgctacagcttgccgaggtgatgcgcacccgcggccacttggtcagtgtgctcgcgccg
gcctccccgcatgccgcactgcctgattactttgtctccggtggtagggcggttccgatt
ccctacaacggctcggtggcccggctgcggttcggtccggcgacccaccgcaaggtcaaa
aagtggcttgcgcatggtgatttcgacgtactgcatctacacgagccgaatgcgccgagc
ctgtcgatgctggccctgaacattgccgagggcccgattgtggcgacatttcacacctcg
accaccaagtcgctgacgctgacggtgttccagggcattctgcggcccatgcacgagaag
atcgtcggccggatcgcggtgtccgacctagcccggcgctggcagatggaggcgttggga
tccgatgcggtggagatccccaatggggtggacgttgattccttcgcctcggcagcgcgg
ctggacgggtacccgcgccagggtaaaacggtgttgttcctgggtcgctacgacgagccc
cgcaagggcatggccgttttgctcgacgcgctgccgaaggtggtgcagcggtttccggat
gtccagctactgatcgtcggccacggcgacgccgaccagttgcgcggccaggcgggccgt
ttggcggcgcacctgcgctttctgggtcaggtggacgacgccggaaaagcttcggcgatg
cgcagcgccgacgtctactgtgcgcccaacaccggcggtgagagtttcggcattgtgctg
gtcgaagcgatggccgccggcactgcggtggtggccagcgacctcgacgccttccggcgt
gtgctgcgcgacggtgaggtcgggcacctggtgccggtggacccgccagacttgcaggcc
gccgcgttggccgatggactgattgcggtgctggagaacgatgtcctgcgggagcgctat
gtggcggccggcaacgcggccgtccgccggtatgactggtcggtggtggccagccagatc
atgcgagtgtacgagacggtcgccgggtcgggcgccaaggttcaggtggccagctga

DBGET integrated database retrieval system