KEGG   Mycobacterium tuberculosis H37Rv: Rv2611cHelp
Entry
Rv2611c           CDS       T00015                                 

Definition
(RefSeq) phosphatidylinositol mannoside acyltransferase
  KO
K02517  
Kdo2-lipid IVA lauroyltransferase [EC:2.3.1.241]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Rv2611c
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.241  Kdo2-lipid IVA lauroyltransferase
     Rv2611c
Lipopolysaccharide biosynthesis proteins [BR:mtu01005]
 Lipid A
  Rv2611c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2939012..2939962)
Genome map
AA seq 316 aa AA seqDB search
MIAGLKGLKLPKDPRSSVTRTATDWAYAAGWMAVRALPEFAVRNAFDTGARYFARHGGPE
QLRKNLARVLGVPPAAVPDPLMCASLESYGRYWREVFRLPTINHRKLARQLDRVIGGLDH
LDAALAAGLGAVLALPHSGNWDMAGMWLVQRHGTFTTVAERLKPESLYQRFIDYRESLGF
EVLPLSGGERPPFEVLSERLRNNRVVCLMAERDLTRTGVEVDFFGEPTRMPVGPAKLAVE
TGAALLPTHCWFEGRGWGFQVYPALDCTSGDVAAITQALADRFAQNIAAHPADWHMLQPQ
WLADLSESRRAQLRSR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccggccttaagggcttgaagctgcccaaagatccgcgcagttccgtgacgcgc
accgcgaccgactgggcgtatgcggccggctggatggccgtacgggcgctgccagagttc
gccgtacgcaacgcattcgacaccggagcgcgctactttgcccgccacggcgggcccgag
cagctgcgcaagaacctggcccgcgtcctgggtgtgccgccagccgcggtgccggacccg
ctgatgtgcgcctcgctggagtcctacgggcgctactggcgtgaggtgttccggctgccg
acgataaaccaccgcaagctggcccgccagctcgaccgcgtgatcggtggactggatcac
ctggacgcggcgctggccgcgggcctcggtgccgtgctggcgttgccgcacagcggcaac
tgggatatggccgggatgtggctggtgcagcggcacggcaccttcaccaccgtcgccgag
cgcctaaaacccgaatcgctgtaccagcgctttatcgactaccgcgaaagcctgggattt
gaggtgctgccgctgtccggcggcgaacggccgccgttcgaggtgctctctgagcggctg
aggaacaaccgagtggtctgcctgatggccgagcgcgatctcacccgcaccggtgttgag
gtcgacttcttcggcgagcccacccggatgccggtggggccggcgaagctggcggtcgag
accggtgcggcattgctgcccacacattgctggttcgagggccgcggctggggtttccag
gtgtatccggcgctggattgcaccagcggtgacgtcgctgccatcacacaggcgctggcc
gaccgcttcgcgcagaacattgccgcccatcccgcggattggcacatgctgcagccccag
tggctggccgacttatccgaatcgcggcgggcgcaactgaggtccagatga

DBGET integrated database retrieval system