KEGG   Mycobacterium tuberculosis H37Rv: Rv2671Help
Entry
Rv2671            CDS       T00015                                 

Gene name
ribD
Definition
(RefSeq) bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase
  KO
K00082  
5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:1.1.1.193]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rv2671 (ribD)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     Rv2671 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2986839..2987615
Genome map
AA seq 258 aa AA seqDB search
MPDSGQLGAADTPLRLLSSVHYLTDGELPQLYDYPDDGTWLRANFISSLDGGATVDGTSG
AMAGPGDRFVFNLLRELADVIVVGVGTVRIEGYSGVRMGVVQRQHRQARGQSEVPQLAIV
TRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEVIACSGDDPGTVDEAVLVS
QLAARGLRRILTEGGPTLLGTFVERDVLDELCLTIAPYVVGGLARRIVTGPGQVLTRMRC
AHVLTDDSGYLYTRYVKT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccgactctggtcagctcggagccgctgacaccccgctaaggctgctcagctcggtg
cattacctcaccgacggcgaactcccccagctttacgactatccggatgacggcacctgg
ttgcgggcgaacttcatcagcagcttggacggcggcgctaccgtcgatggcaccagcggg
gcgatggccgggcccggcgaccgattcgtcttcaacctgttgcgtgaacttgccgacgtc
atcgtggtcggcgtgggcaccgtgcgcattgagggctactccggcgtccggatgggtgtc
gtccagcgccagcaccggcaggcccgaggccaaagcgaagttccgcaactggcaatcgtc
accaggtccggtcgccttgaccgtgacatggcggtattcacccggaccgagatggcaccg
ttggtgctcaccaccacggcggtcgccgatgacacgcgccagcggctcgcgggcctcgcc
gaggtgatcgcgtgctccggcgacgatccgggcacggtcgatgaggcagtgctcgtgtcc
cagctcgcggctcgcggtctgcgccggatccttaccgaaggcgggccgacgttgctcggg
acattcgtcgagcgtgacgtgctcgacgagctgtgtctgacgatcgccccctacgtcgtc
ggcggcctggcgcgccgcatagtgacgggacccgggcaggtgctgacccggatgcgctgt
gcccatgtcctcaccgacgactccggctacctgtacacccgctacgtcaagacctga

DBGET integrated database retrieval system