KEGG   Mycobacterium tuberculosis H37Rv: Rv2678cHelp
Entry
Rv2678c           CDS       T00015                                 

Gene name
hemE
Definition
(RefSeq) uroporphyrinogen decarboxylase
  KO
K01599  
uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2678c (hemE)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     Rv2678c (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2993989..2995062)
Genome map
AA seq 357 aa AA seqDB search
MSTRRDLPQSPYLAAVTGRKPSRVPVWFMRQAGRSLPEYRALRERYSMLAACFEPDVACE
ITLQPIRRYDVDAAILFSDIVVPLRAAGVDLDIVADVGPVIADPVRTAADVAAMKPLDPQ
AIQPVLVAASLLVAELGDVPLIGFAGAPFTLASYLVEGGPSRHHAHVKAMMLAEPASWHA
LMAKLTDLTIAFLVGQIDAGVDAIQVFDSWAGALSPIDYRQYVLPHSARVFAALGEHGVP
MTHFGVGTAELLGAMSEAVTAGERPGRGAVVGVDWRTPLTDAAARVVPGTALQGNLDPAV
VLAGWPAVERAARAVVDDGRRAVDAGAAGHIFNLGHGVLPESDPAVLADLVSLVHSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccgtcgcgaccttccgcagtcgccgtatctggccgccgtcaccggccgcaag
cccagccgggtgccggtgtggttcatgcggcaggccgggcgctcgttgcccgaataccgg
gcgctgcgcgagcggtacagcatgctggcggcctgtttcgaaccggacgtggcctgtgag
attaccctgcagccgatacgccgctacgacgtcgacgcggccatcctgttctccgacatc
gtggtgccgctacgggcggccggcgtggatttggacatcgtcgccgacgttgggccggtg
atcgcggacccggtgcgcaccgccgccgatgtcgccgccatgaaaccacttgatccacaa
gcgattcaaccggtattggtggcggcttcgttgttggtcgctgagcttggcgacgtgccg
ctgatcggtttcgccggcgcgccgttcacgctggcctcctacctcgtggagggcggaccg
agccgccatcacgcccacgtcaaggcgatgatgttggccgagccggcgagctggcacgcg
ctgatggccaagctgaccgacctcaccatcgcgtttctggtcggccaaatcgacgcgggg
gtggacgccatccaggtattcgactcctgggccggggcgctctcgccgatcgactaccgc
cagtacgtgttgccgcacagcgcccgggtgttcgctgcgctgggcgagcatggcgtgccg
atgacgcacttcggggttgggaccgccgaattgctgggcgcgatgtcggaggccgtgaca
gccggggagcggccaggccgaggggccgtcgtcggcgtggactggcggaccccgctgacc
gacgccgccgcccgggtggtgcccggcacggcgttacagggcaacctcgatccggcggtg
gtcctggcgggctggccggcggtggaacgtgccgcacgtgccgttgtcgacgacggacgc
cgcgccgtcgacgccggtgcggccggccatatcttcaacctcggccacggggtgctgcca
gaaagcgatcccgcggtgctggccgacctggtctcgctcgtacactcgctatga

DBGET integrated database retrieval system