KEGG   Mycobacterium tuberculosis H37Rv: Rv2726cHelp
Entry
Rv2726c           CDS       T00015                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2726c (dapF)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2726c (dapF)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Rv2726c (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3038931..3039800)
Genome map
AA seq 289 aa AA seqDB search
MIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVL
DSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPV
TCHHVEAAYADVSVDMGKANRLGAGEAVVGGRRFHGLAVDVGNPHLACVDSQLTVDGLAA
LDVGAPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAA
VGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgcgaagggccacggtacccagaacgacttcgtgttgctgcctgacgtcgac
gccgagttggtgctcaccgctgcccgggtggcggcattgtgcgaccggcggaaggggctg
ggcgccgacggggtgttgcgggttacgaccgccggagccgcccaggcggtaggagtgctg
gacagcctgcccgagggtgtccgcgtgaccgactggtacatggattaccgcaacgccgac
gggtcggcagcccagatgtgcggcaacggtgtgcgagtgttcgcgcactacttgcgtgcc
agtggcctggaggttcgcgacgagttcgtcgtagggtcactggccggaccgcgaccagtc
acctgccaccacgtcgaggcggcctacgccgacgtctccgtcgacatgggcaaggccaac
agattgggcgcaggggaggctgttgttggtggcaggcggtttcacggcctggccgtcgat
gtgggtaacccgcatctggcgtgcgtggattcccagctgaccgtcgacggcctggcggca
ttggacgtgggtgcgccggtgagtttcgatggtgcgcagttccccgacggggtcaatgtc
gaggtactcaccgcgccggtcgacggggcggtctggatgcgggttcacgaacgcggcgtg
ggggaaacccgctcgtgtggcaccgggacggttgcggccgcggtcgccgcgttggcggcg
gtgggctcgccgaccggaacgctcaccgtgcacgtgccgggcggagaggtcgtggttacc
gtcaccgatgccaccagcttcctgcgtgggccgtcagtgttggtggcccgcggagatctc
gctgacgattggtggaacgcgatggggtga

DBGET integrated database retrieval system