KEGG   Mycobacterium tuberculosis H37Rv: Rv2747Help
Entry
Rv2747            CDS       T00015                                 

Gene name
argA
Definition
(RefSeq) L-glutamate alpha-N-acetyltranferase
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rv2747 (argA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Rv2747 (argA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_CG FR47
Motif
Other DBs
NCBI-GeneID: 888407
NCBI-ProteinID: NP_217263
TubercuList: Rv2747
UniProt: O33289 I6X596
Structure
PDB: 

Jmol
Position
3059262..3059786
Genome map
AA seq 174 aa AA seqDB search
MTERPRDCRPVVRRARTSDVPAIKQLVDTYAGKILLEKNLVTLYEAVQEFWVAEHPDLYG
KVVGCGALHVLWSDLGEIRTVAVDPAMTGHGIGHAIVDRLLQVARDLQLQRVFVLTFETE
FFARHGFTEIEGTPVTAEVFDEMCRSYDIGVAEFLDLSYVKPNILGNSRMLLVL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacgtccacgggattgccggccggtggtccggcgcgcgcgaacctccgatgtg
cccgcgatcaaacaactcgtcgacacctatgccggaaagatcttgctggaaaagaatctc
gtgacactctatgaagcggttcaggaattctgggtggccgagcacccggacctctatggc
aaagtcgtcggttgcggtgcgttgcacgtgttgtggtcggatctcggcgaaatccgcacc
gtcgctgtcgacccggccatgaccggccacggtatcggccacgcaatcgtcgatcggcta
ctgcaggtcgcccgcgatctgcagctgcagcgcgtgttcgtgttgacctttgagaccgag
ttcttcgcccggcacggattcaccgagatcgagggcaccccggtcaccgccgaggtgttc
gacgagatgtgccgctcctatgacatcggggtcgccgaattcctggacctgagctacgtc
aagcccaacatcctcggcaactcccggatgctgctggtgctgtag

DBGET integrated database retrieval system