KEGG   Mycobacterium tuberculosis H37Rv: Rv2753cHelp
Entry
Rv2753c           CDS       T00015                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2753c (dapA)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2753c (dapA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv2753c (dapA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Rv2753c (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3066222..3067124)
Genome map
AA seq 300 aa AA seqDB search
MTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPT
TTDGEKIELLRAVLEAVGDRARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKP
PQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRALASHPNIVGVKDAKADLHSG
AQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI
NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgtcggattcgacgtcgcagcgcgcctaggaaccctgctgaccgcgatggtg
acaccgtttagcggcgatggctccctggacaccgccaccgcggcgcggctggccaaccac
ctggtcgatcaggggtgcgacggtctggtggtctcgggcaccaccggcgagtcgccgacc
accaccgacggggagaaaatcgagctgctgcgggccgtcttggaagcggtgggggaccgg
gcccgtgttatcgccggtgccggcacctatgacaccgcgcacagcatccggctggccaag
gcttgtgcggccgagggtgcgcacgggctgctggtggtcacgccctactattccaagccg
ccgcagcgggggctgcaagcccatttcaccgccgtcgccgacgcgaccgagctgccgatg
ctgctctatgacatcccggggcggtcggcggtgccgatcgagcccgacacgatccgcgcg
ttggcgtcgcatccgaacatcgtcggagtcaaggacgccaaagccgacctgcacagcggc
gcccaaatcatggccgacaccggactggcctactattccggcgacgacgcgctcaacctg
ccctggctggccatgggcgccacgggcttcatcagcgtgattgcccacctggcagccggg
cagcttcgagagttgttgtccgccttcggttctggggatatcgccaccgcccgcaagatc
aacattgcggtcgccccgctgtgcaacgcgatgagccgcctgggtggggtgacgttgtcc
aaggcgggcttgcggctgcagggcatcgacgtcggtgatccccggctgccccaggtggcc
gcgacaccggagcagatcgacgcgttggccgccgacatgcgcgcggcctcggtgcttcgg
tga

DBGET integrated database retrieval system