KEGG   Mycobacterium tuberculosis H37Rv: Rv2764cHelp
Entry
Rv2764c           CDS       T00015                                 

Gene name
thyA
Definition
(RefSeq) thymidylate synthase ThyA
  KO
K00560  
thymidylate synthase [EC:2.1.1.45]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv2764c (thyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv2764c (thyA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     Rv2764c (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3073680..3074471)
Genome map
AA seq 263 aa AA seqDB search
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL
WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR
TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS
YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFE
YTYEDIVVKNYDPHPAIKAPVAV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccatacgaggacctgctgcgcttcgtgctcgaaacgggtacgcccaaatccgac
cgcaccggcaccggaacccgcagcctgttcggccagcagatgcgctatgatttgtcggcc
ggtttcccgctgctcactaccaagaaagtccatttcaaatcggtagcctacgagctgctg
tggtttttgcgcggcgattccaatatcggttggctgcacgagcacggagtcaccatctgg
gacgaatgggcaagtgatacaggcgaactcgggccgatctacggtgtacaatggcgatcg
tggccggctccatccggtgagcacatcgaccagatcagcgcggcgctggatttgctgcgc
accgatcccgattcccggcgcatcatcgtgtcggcctggaacgtcggcgaaatcgagcgg
atggcgctgccgccctgtcatgcgttcttccagttctacgtcgccgatggccggctgagc
tgtcagctctaccaacgcagcgccgacctgtttctgggtgtgccgttcaacatcgccagc
tatgcgttgctcacccacatgatggccgcccaggccggcttgtcggtcggcgagttcatc
tggaccggtggcgactgccacatctacgacaatcacgtcgagcaagtacggctgcagctc
agccgcgagccgcggccatatccgaaactacttctagccgaccgggattcaatcttcgag
tacacctatgaagacatcgttgtgaagaactacgatccgcatccggcgatcaaagctcca
gtcgcggtatga

DBGET integrated database retrieval system