KEGG   Mycobacterium tuberculosis H37Rv: Rv2773cHelp
Entry
Rv2773c           CDS       T00015                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  
4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2773c (dapB)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2773c (dapB)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv2773c (dapB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     Rv2773c (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3081604..3082341)
Genome map
AA seq 245 aa AA seqDB search
MRVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMG
NLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAA
RFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGI
PVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEP
LLDLH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaggcgtccttggagccaaaggcaaggtcggagcgacgatggtgcgggcggtg
gcggccgccgacgacctgaccctatccgccgagctggatgccggcgatccgctgagcctg
ctaacggacggtaacaccgaggtcgtcatcgacttcacccacccggacgtggtgatgggc
aatctggagttcctcatcgacaacggaattcacgccgtggtcggtaccacggggttcacc
gccgagcggtttcaacaagtcgaatcgtggctcgtcgcaaaacccaacacatcggtgttg
atagcgccaaacttcgcgatcggagcggtgctgtccatgcatttcgccaagcaggccgca
cggtttttcgactcggccgaggtcattgagctgcatcatccgcacaaggctgacgcgccg
tcaggcacggccgcgcgtaccgcgaagctgatcgccgaggcccgaaaaggcttgccgccc
aatcccgatgccaccagtaccagcctgccgggcgcgcgtggtgccgacgtcgacggcata
ccggtgcacgcggtgcggctggccggactggtcgcccaccaggaggtgctgttcgggacc
gagggggagactctgaccatccgccacgatagcctcgatcgcacatcgtttgtgcccggt
gtgctgttggcggtgcgccgcatcgccgaacgccctggtctcaccgtaggtcttgagccc
ctactcgatctgcactga

DBGET integrated database retrieval system