KEGG   Mycobacterium tuberculosis H37Rv: Rv2786cHelp
Entry
Rv2786c           CDS       T00015                                 

Gene name
ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rv2786c (ribF)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Rv2786c (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     Rv2786c (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3093905..3094900)
Genome map
AA seq 331 aa AA seqDB search
MRRRLAIVQRWRGQDEIPTDWGRCVLTIGVFDGVHRGHAELIAHAVKAGRARGVPAVLMT
FDPHPMEVVYPGSHPAQLTTLTRRAELVQDLGIEVFLVMPFTTDFMKLTPDRFIHELLVE
HLHVVEVVVGENFTFGKKAAGNVDTLRRAGERFGFAVESMSLVSEHHSNETVTFSSTYIR
SCVDAGDMVAAMEALGRPHRVEGVVVRGEGRGAELGFPTANVAPPMYSAIPADGVYAAWF
TVLGHGPVTGTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTTADLYGQHVALDFVGR
IRGQKKFESVRQLVAAMGADTERARDLLSTG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtaggcttgcgatcgtgcagcgctggcgtggccaggacgagatcccgacggat
tggggcagatgcgtgctcaccatcggggtatttgacggcgtgcaccgcgggcacgccgaa
ctgatcgcgcacgcggtcaaggccggccgcgctcgcggtgtaccggccgtgctgatgacg
ttcgacccgcacccgatggaggtggtctatccaggcagtcacccggcgcagctgaccacc
ctgacccgacgcgcggagctcgttcaagacttgggcatcgaagtgttcctggtgatgccg
ttcaccaccgatttcatgaagctcacgccggatcgcttcatccatgagctgctcgtcgag
cacctacatgtggtggaggtcgtcgtcggcgagaacttcaccttcggcaaaaaggccgcc
ggcaatgtcgacacgctgcgtcgggctggcgagcggttcgggttcgcggtggaatcgatg
tcgttggtgtccgagcaccacagcaacgagaccgtgacgttctcctccacctacatccgg
tcctgcgtggacgccggcgacatggtggcggccatggaagctctgggccgaccgcaccgc
gtggagggggttgtggtacgcggtgaggggcggggcgcggagctgggctttcccaccgcg
aacgtggcgccgccgatgtattcggcgattccggccgacggcgtgtacgccgcttggttc
acggtgctcgggcatgggccggtgaccggcacggtcgtcccgggtgagcgctaccaggcc
gcggtgtcggtcgggaccaatcccaccttctccggacgcacccgcaccgtcgaagcgttc
gtgctggacaccaccgctgacctctacggtcaacatgtggccttggacttcgtcgggcgt
atccgcggccagaagaagttcgaatcggtgcgccagctggtcgctgcgatgggtgccgat
accgagcgggcacgtgacctgttgtctacgggttga

DBGET integrated database retrieval system