KEGG   Mycobacterium tuberculosis H37Rv: Rv2833cHelp
Entry
Rv2833c           CDS       T00015                                 

Gene name
ugpB
Definition
(RefSeq) sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB
  KO
K05813  
sn-glycerol 3-phosphate transport system substrate-binding protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
ABC transporters
Module
Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rv2833c (ugpB)
Transporters [BR:mtu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    Rv2833c (ugpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3139174..3140484)
Genome map
AA seq 436 aa AA seqDB search
MDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSSAAERELIGRF
QDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLLDDRWWFHFALSGVLTALDDL
FGQVGVDTTDYVDSLLADYEFNGRHYAVPYARSTPLFYYNKAAWQQAGLPDRGPQSWSEF
DEWGPELQRVVGAGRSAHGWANADLISWTFQGPNWAFGGAYSDKWTLTLTEPATIAAGNF
YRNSIHGKGYAAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPDAAP
ACPTGGAGLAIPAKLSEERKVNALKFIAFVTNPTNTAYFSQQTGYLPVRKSAVDDASERH
YLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLESIGLRGADVTKTFTNIQKRL
QVILDRQIMRKLAGHG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacccgctgaaccgccgacaattcctcgcgctggccgctgccgccgccggcgtgacc
gccggctgcgccgggatgggcggcggcggttcggtgaagtccggttccggcccaatcgac
ttctggtccagtcatcccggccaatccagcgcggcggaacgggagctgatcggtcgtttc
caggaccgattccccactctgtcggtcaagctgatcgacgccggcaaggactacgacgag
gtggcacagaaattcaatgcggcgctcatcggaaccgacgtgcccgacgtcgttttgctc
gacgaccgatggtggttccatttcgccctcagcggtgttctcactgcccttgacgacctg
ttcggccaagttggggtggacacaacggattacgtcgattcgctgctggccgactatgag
ttcaacggccgccattacgctgtgccgtatgctcgctcgacgccgctgttctactacaac
aaggcggcgtggcaacaggccggcctacccgaccgcggaccgcaatcctggtcagagttc
gacgagtggggtccggagttacagcgcgtggtcggcgccggtcgatcggcgcacggctgg
gctaacgccgacctcatctcgtggacgtttcagggaccgaactgggcattcggcggtgcc
tactccgacaagtggacattgacattgaccgagcccgccacgatcgcggccggcaacttc
tatcggaactccatccatggcaagggttatgcggcggtcgccaacgatattgccaacgag
ttcgccaccggaatcctggcctcggccgtggcatccaccggctcgctggccggcatcacc
gcatctgcccgattcgacttcggcgccgcaccgctgcccacgggcccggacgcagcgccc
gcctgtccgacgggcggtgcggggctggcgataccggccaagctctccgaggagcgaaaa
gtcaacgcgctcaagttcatcgcattcgtcaccaacccgacgaacaccgcctacttcagc
cagcaaaccggctatctgccggtgcgcaagtccgccgtcgacgatgccagcgaacggcac
tatctggcggacaatccccgtgcgcgggtggcgctcgaccagctgccacacacccggaca
caagactacgcacgggttttcctgcccggtggtgaccggatcatctccgccggcctggaa
tccatcgggctgcgcggagccgacgtgaccaagaccttcacgaacatccaaaaacggttg
caggtcatcctggatcggcagatcatgcggaagctggcggggcatggctaa

DBGET integrated database retrieval system