KEGG   Mycobacterium tuberculosis H37Rv: Rv2848cHelp
Entry
Rv2848c           CDS       T00015                                 

Gene name
cobB
Definition
(RefSeq) cobyrinic acid A,C-diamide synthase
  KO
K02224  
cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2848c (cobB)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     Rv2848c (cobB)
    6.3.5.11  cobyrinate a,c-diamide synthase
     Rv2848c (cobB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3156148..3157521)
Genome map
AA seq 457 aa AA seqDB search
MRVSAVAVAAPASGSGKTTIATGLIGALRQAGHTVAPFKVGPDFIDPGYHALAAGRPGRN
LDPVLVGERLIGPLYAHGVAGADIAVIEGVLGLFDGRIGPAGGAPAAGSTAHVAALLGAP
VILVVDARGQSHSVAALLHGFSTFDTATRIAGVILNRVGSARHEQVLRQACDQAGVAVLG
AIPRTAELELPTRYLGLVTAVEYGRRARLAVQAMTAVVARHVDLAAVIACAGSQAAHPPW
DPVIAVGNTARQPATVAIAAGRAFTFGYAEHAEMLRAAGAEVVEFDPLSETLPEGTDAVV
LPGGFPEQFTAELSANDTVRRQINELAAAGAPVHAECAGLLYLVSELDGHPMCGVVAGSA
RFTQHLKLGYRDAVAVVDSALYSVGERVVGHEFHRTAVTFADSYQPAWVYQGQDVDDVRD
GAVHSGVHASYLHTHPAATPGAVARFVAHAACNTPRA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtatccgcggtggccgtcgccgcgcctgcgtcgggcagcggtaagaccacgatc
gcgacgggcttgatcggagcgctgcggcaggccggtcacaccgtcgcgccgtttaaggta
ggcccggattttatcgaccccggctatcacgccctggccgcgggacggcccggccgcaat
ctcgacccggtactggtgggggagcggcttatcggccccctgtacgcgcatggagttgcg
ggcgcggacatcgccgtgatcgaaggggtgctggggctgttcgacgggcgcattgggcct
gccgggggcgcgcccgcagcggggtccaccgcgcacgtcgctgctctgcttggcgccccg
gtgatcctggtggtcgatgcccgcggccagagtcacagcgttgccgcactgctgcacggc
ttttccacgttcgacaccgcaactcggatcgccggtgtcatcctcaaccgggtcggatcg
gcccgacatgaacaggtgctgcgacaggcgtgtgaccaggccggtgtcgcggtcttgggc
gccattccacgcacagctgaactagagctgccgacaaggtatctgggtctggttaccgcc
gtcgagtacggccgtcgcgcacggctcgccgtgcaggcgatgactgctgtggtcgctcgc
cacgtcgatctggccgcggtgatcgcctgcgccgggagccaggcggcccacccgccatgg
gacccggtgattgccgtcggcaacaccgcccgccagccagccacggttgccatcgcggcc
ggaagggcgtttaccttcggctacgccgaacacgccgagatgttgcgcgccgccggggct
gaagtggtcgagttcgacccgctcagcgaaactctgcccgagggtacggacgcggtggtg
ttgcccggcggattccccgagcagttcaccgccgagttgtccgccaacgacaccgtccgg
cggcagatcaacgaactggccgctgccggcgccccggtgcatgccgaatgtgccggcctg
ctctatctggtttctgaactcgacggacacccgatgtgcggtgtggtggccggatcggcg
cggttcacccagcatctcaagctgggttatcgcgacgccgtcgcggttgttgattcggcg
ctgtactccgtcggcgagcgcgtggttggacatgaattccaccgaaccgcagtcacattc
gccgatagctatcagcccgcgtgggtgtaccagggccaagacgtggacgacgtgcgagac
ggcgcggtgcacagcggcgtgcacgcgtcctacctgcatacccatccggccgcaacaccc
ggtgcggtggcgcgtttcgtcgcacatgcggcctgcaatactccacgagcgtaa

DBGET integrated database retrieval system