KEGG   Mycobacterium tuberculosis H37Rv: Rv2849cHelp
Entry
Rv2849c           CDS       T00015                                 

Gene name
cobO
Definition
(RefSeq) cob(I)alamin adenosyltransferase
  KO
K19221  
cob(I)alamin adenosyltransferase [EC:2.5.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2849c (cobO)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.17  cob(I)yrinic acid a,c-diamide adenosyltransferase
     Rv2849c (cobO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3157521..3158144)
Genome map
AA seq 207 aa AA seqDB search
MPQGNPLAVPNDGLTTRARRNMPILAVHTGEGKGKSTAAFGMALRAWNAGLDIAVFQFVK
SAKWKVGEEAAFRQLGRLHDQHGIGGAVEWHKMGAGWSWTRTSRKAGTDVDRAAAAADGW
AEIALRLATQRHDFYLLDEFTYPLKWGWLDVDEVVDVLRARPGHQHVVITGRDAPQRLVA
AADLVTEMTKVKHPMDAGRKGQKGIEW
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagggcaatccgctcgcagtgcccaacgatggcctgaccacccgggcccggcgc
aacatgccgatactggcggtacacaccggtgaaggcaaaggaaaatcgaccgcggcgttc
ggaatggcgttgcgggcgtggaacgctggtctggacatcgcggtgtttcagtttgtcaag
agcgctaagtggaaagtgggtgaggaggcggcgtttcgtcaactgggccggctgcacgac
cagcacgggatcggcggagcggtggagtggcacaagatgggtgcgggctggtcctggaca
cgtacgtctcgcaaggccggcaccgacgtcgatcgtgcggccgcggcggcggacggttgg
gccgagatcgcgctccggctggccacgcaacgtcacgacttctatctgctggacgagttc
acctacccactgaagtggggttggctcgacgtcgacgaagtcgtcgatgtcctgcgagcc
cggcctggccatcagcatgtggtgatcaccgggcgagacgcaccccagcggttggttgcg
gccgccgatctggtgaccgagatgaccaaggtgaagcacccgatggatgcgggccgcaag
gggcagaagggcatcgagtggtga

DBGET integrated database retrieval system