KEGG   Mycobacterium tuberculosis H37Rv: Rv2858cHelp
Entry
Rv2858c           CDS       T00015                                 

Gene name
aldC
Definition
(RefSeq) aldehyde dehydrogenase AldC
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2858c (aldC)
   00053 Ascorbate and aldarate metabolism
    Rv2858c (aldC)
   00620 Pyruvate metabolism
    Rv2858c (aldC)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv2858c (aldC)
   00561 Glycerolipid metabolism
    Rv2858c (aldC)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv2858c (aldC)
   00310 Lysine degradation
    Rv2858c (aldC)
   00330 Arginine and proline metabolism
    Rv2858c (aldC)
   00340 Histidine metabolism
    Rv2858c (aldC)
   00380 Tryptophan metabolism
    Rv2858c (aldC)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv2858c (aldC)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rv2858c (aldC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv2858c (aldC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Rv2858c (aldC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3169356..3170723)
Genome map
AA seq 455 aa AA seqDB search
MSTTQLINPATEEVLASVDHTDANAVDDAVQRARAAQRRWARLAPAQRAAGLRAFAAAVQ
AHLDELAALEVANSGHPIVSAEWEAGHVRDVLAFYAASPERLSGRQIPVAGGVDVTFNEP
MGVVGVITPWNFPMVIASWAIAPALAAGNAVLVKPAELTPLTTMRLGELAVEAGLDEDLL
QVLPGKGTVVGERFVTHPDIRKIVFTGSTEVGKRVMAGAAAQVKRVTLELGGKSANIVFH
DCDLERAATTAPAGVFDNAGQDCCARSRILVQRSVYDRFMELLEPAVHSIVVGDPGSRAT
EMGPLVSRAHRDKVAGYVPDDAPVAFRGTAPAGRGFWFPPTVLTPKRGDRTVTDEIFGPV
VVVLTFDDEADAISLANDTAYGLSGSIWTDDLSRALRVARAVESGNLSVNSHSSVRFNTP
FGGFKQSGVGRELGPDAPLQFTETKNVFIAVGEEM
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccacgcaactgatcaatcccgccaccgaggaagtgctggcctcagttgaccac
accgacgccaacgcggtggacgacgccgtgcaacgcgcgcgagcagcgcagcggcgctgg
gcacggttggcaccggcgcagcgggcggccggcctgcgcgcattcgcggcagccgtgcaa
gcccacctcgacgaactggccgcgctcgaggtagccaattccggacatccgatcgtgtcg
gccgagtgggaagccggccacgtgcgtgacgtgttggcgttctatgccgccagcccggaa
cggttgtccggcaggcagattcccgttgccggcggggtggacgtcactttcaacgaaccg
atgggcgtggtcggtgtgatcacgccatggaatttcccgatggtgatcgcgtcctgggcc
atcgcgccggcgctggccgccggcaacgcggtgctggtcaaacccgccgaactgacgccg
ctgaccacgatgcggctcggtgagctggccgtcgaggcgggtctggacgaagacctgctg
caggtgttgccgggaaagggcacggtggtcggggagcggttcgtcacccaccccgacatt
cgcaagatcgtgttcaccgggtccaccgaagtcggcaagcgggtcatggccggtgccgcg
gctcaagtcaaacgagtgacgttggaactgggtggcaagagcgccaacatcgtcttccac
gactgcgacctggagcgcgccgcgacgaccgcgccggccggggtcttcgacaacgctggg
caggattgctgtgcccgaagtcgaatcctggtgcagcgcagcgtttacgaccggtttatg
gagctgctcgagccggcggtacacagcattgtcgtcggggaccccggatcacgcgccacc
gagatgggtccgctggtatcgcgcgcacaccgtgacaaggtcgccggttatgtgcccgac
gacgctccggtggcgtttcggggtacggctccggctgggcgcggattttggtttccacca
accgttctcacacccaaacgcggcgaccgcaccgtcaccgacgaaatcttcgggccggtg
gttgtagtgctgacgttcgacgacgaggccgacgctatcagcctggccaacgacaccgcg
tacgggctgtccggatcgatctggaccgatgacctgtcccgcgcgctgcgggtggcgcgg
gcggtcgaatccggcaacctgtcggtaaactcgcactcgtcggtgcgcttcaacaccccg
tttggcggtttcaagcagtccggtgtgggccgcgagctagggccggacgctccgctgcag
ttcaccgaaaccaaaaatgtgttcatcgccgtcggggaggagatgtga

DBGET integrated database retrieval system