KEGG   Mycobacterium tuberculosis H37Rv: Rv2868cHelp
Entry
Rv2868c           CDS       T00015                                 

Gene name
gcpE
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)
  KO
K03526  
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv2868c (gcpE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     Rv2868c (gcpE)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     Rv2868c (gcpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3179368..3180531)
Genome map
AA seq 387 aa AA seqDB search
MTVGLGMPQPPAPTLAPRRATRQLMVGNVGVGSDHPVSVQSMCTTKTHDVNSTLQQIAEL
TAAGCDIVRVACPRQEDADALAEIARHSQIPVVADIHFQPRYIFAAIDAGCAAVRVNPGN
IKEFDGRVGEVAKAAGAAGIPIRIGVNAGSLDKRFMEKYGKATPEALVESALWEASLFEE
HGFGDIKISVKHNDPVVMVAAYELLAARCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSR
GIGDTIRVSLSAPPVEEVKVGNQVLESLNLRPRSLEIVSCPSCGRAQVDVYTLANEVTAG
LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVPEAQIVETLIE
EAMRLAAEMGEQDPGATPSGSPIVTVS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtaggcttgggcatgccgcagcccccggcacccacgctcgctccccggcgcgcc
acccgtcagctgatggtcggcaacgtcggcgtgggcagtgaccatccggtctcggtgcaa
tcgatgtgcaccaccaaaacccacgacgtcaactcgacattgcaacaaatcgccgagctg
accgcggccggatgcgacatcgtgcgggtggcctgcccgcgccaggaggacgccgacgcg
ctggccgagatcgcccggcacagccagatcccggtagtcgcggacatacatttccagccg
cgctacatattcgccgccatcgacgctggatgtgccgcggtgcgggtcaacccgggcaac
atcaaggagtttgacggccgggtgggtgaggtcgccaaggcggcgggtgcggccgggatc
ccgatccgaatcggtgtcaacgccggttcgctggacaaacggttcatggagaagtatggc
aaagccacgcccgaggcgctggttgagtcggcgctgtgggaggcttcgcttttcgaggag
catggcttcggtgacatcaagatcagcgtcaagcacaacgacccggtggtgatggtcgcc
gcctacgagctgcttgctgcacggtgcgactacccactgcacctcggtgtcaccgaggcc
ggccctgctttccagggcaccatcaagtccgcggttgccttcggcgcgttgctgtcgcgg
ggcataggcgacaccatccgggtgtcgttgtcggccccgccggtcgaggaagtcaaggtg
ggcaatcaggttctcgagtcgttgaacctgcggccgcgttcgctcgagatcgtgtcttgc
ccgtcgtgcggtcgcgcgcaagtcgacgtctacaccctggccaacgaggtaaccgccggc
ctggatggtctcgatgtgccgttgcgggtggccgtgatggggtgtgtcgtcaatggtccg
ggtgaagcacgtgaggccgacctgggcgtggcgtccggcaacggcaaaggtcagatcttt
gtacggggcgaagtgatcaagaccgtgcccgaagcacagatcgtcgagacgctgatcgag
gaggcgatgcggctggccgccgaaatgggcgagcaagatccgggcgcgacaccgagcggt
tcgcctattgtgaccgtaagctga

DBGET integrated database retrieval system