KEGG   Mycobacterium tuberculosis H37Rv: Rv2881cHelp
Entry
Rv2881c           CDS       T00015                                 

Gene name
cdsA
Definition
(RefSeq) phosphatidate cytidylyltransferase
  KO
K00981  
phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv2881c (cdsA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     Rv2881c (cdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3190701..3191621)
Genome map
AA seq 306 aa AA seqDB search
MTTNDAGTGNPAEQPARGAKQQPATETSRAGRDLRAAIVVGLSIGLVLIAVLVFVPRVWV
AIVAVATLVATHEVVRRLREAGYLIPVIPLLIGGQAAVWLTWPFGAVGALAGFGGMVVVC
MIWRLFMQDSVTRPTTGGAPSPGNYLSDVSATVFLAVWVPLFCSFGAMLVYPENGSGWVF
CMMIAVIASDVGGYAVGVLFGKHPMVPTISPKKSWEGFAGSLVCGITATIITATFLVGKT
PWIGALLGVLFVLTTALGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGILPSAVAAWI
VLTLLP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaacgatgccggcaccggaaaccccgccgagcagccggcgcgtggtgctaaa
cagcagccggcgaccgaaacgtcccgcgccggccgtgatttgcgcgcagcgatcgtggtg
ggcctttccataggcctagtcctcatcgcggtgctggtgttcgttccgcgcgtttgggtt
gccatcgtggccgtcgccaccttggtcgctacccatgaggtggtgcggaggttgcgggaa
gcgggctatctcatcccggttatcccgttgctgattggcgggcaggccgcggtgtggctg
acctggccgttcggcgcggtcggcgcattggcgggctttggtggcatggtcgttgtctgc
atgatttggcgactgttcatgcaggacagcgtgacgcgcccgacgaccggcggtgcaccg
tcgccgggaaactacttgtccgacgtctcggccacggtcttcctggccgtgtgggtccca
ttgttctgctctttcggcgcaatgctggtctacccggaaaatggctcgggatgggtgttc
tgcatgatgatcgcggtcatcgcttccgatgtcggcggctacgccgtgggggtgctgttt
ggcaagcatccgatggttccgacgatcagcccgaagaagtcgtgggagggctttgccggt
tcgctggtgtgcgggatcaccgcaacgatcatcaccgcgactttcctggtcggcaaaacg
ccgtggattggtgcactgctcggcgtgcttttcgtgctcaccaccgcgctgggcgacctg
gtggagtcgcaggtcaaacgtgacctcggcatcaaagacatgggccgcctgctacccggc
cacggcggtctgatggaccggctcgacggcatactgccttccgcggtggcggcctggata
gtcctcacactgctgccctga

DBGET integrated database retrieval system