KEGG   Mycobacterium tuberculosis H37Rv: Rv2900cHelp
Entry
Rv2900c           CDS       T00015                                 

Gene name
fdhF
Definition
(RefSeq) formate dehydrogenase subunit alpha FdhF
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3209406..3211745)
Genome map
AA seq 779 aa AA seqDB search
MYVEAVRWQRSAASRDVLADYDEQAVTVAPRKREAAGVRAVMVSLQRGMQQMGALRTAAA
LARLNQRNGFDCPGCAWPEEPGGRKLAEFCENGAKAVAEEATKRTVTAEFFARHSVAELS
AKPEYWLSQQGRLAHPMVLRPGDDHYRPISWDAAYQLIAEQLNGLDSPDRAVFYTSGRTS
NEAAFCYQLLVRSFGTNNLPDCSNMCHESSGAALTDSIGIGKGSVTIGDVEHADLIVIAG
QNPGTNHPRMLSVLGKAKANGAKIIAVNPLPEAGLIRFKDPQKVNGVVGHGIPIADEFVQ
IRLGGDMALFAGLGRLLLEAEERVPGSVVDRSFVDNHCAGFDGYRRRTLQVGLDTVMDAT
GIELAQLQRVAAMLMASQRTVICWAMGLTQHAHAVATIGEVTNVLLLRGMIGKPGAGVCP
VRGHSNVQGDRTMGIWEKMPEQFLAALDREFGITSPRAHGFDTVAAIRAMRDGRVSVFMG
MGGNFASATPDTAVTEAALRRCALTVQVSTKLNRSHLVHGATALILPTLGRTDRDTRNGR
KQLVSVEDSMSMVHLSRGSLHPPSDQVRSEVQIICQLARALFGPGHPVPWERFADDYDTI
RDAIAAVVPGCDDYNHKVRVPDGFQLPHPPRDAREFRTSTGKANFAVNPLQWVPVPPGRL
VLQTLRSHDQYNTTIYGLDDRYRGVKGGRRVVFINPADIETFGLTAGDRVDLVSEWTDGQ
GGLQERRAKDFLVVAYSTPVGNAAAYYPETNPLVPLDHTAAQSNTPVSKAIIVRLEPTA
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttgaggcggtgaggtggcagcggtcggcggcgtctcgcgacgtcctcgccgac
tatgacgagcaggcggtaacggtggcgccgcgcaaacgcgaggccgcgggcgtgcgggcg
gtgatggtatcgctgcagcgggggatgcagcagatgggcgcgctgcgcaccgcggcggcg
ctggctcggttgaatcagcgtaacggcttcgactgcccaggctgcgcgtggccggaggag
cccggcggacgcaagctggccgagttctgcgagaacggcgccaaggcagtcgccgaagag
gccaccaagcgtaccgtcactgcggagttcttcgctcggcactcggtggcggagctgtcc
gcgaagcccgaatattggctgtcccagcaaggccggctcgcccacccgatggtcttgcgc
cccggtgatgaccactaccggcccatcagctgggatgccgcttatcagctgatcgccgag
cagctcaacgggttggacagtcccgaccgggccgtgttctacacatcggggcgcaccagc
aacgaagcggcgttctgttaccagctgctcgtgcgctctttcggcaccaacaacctgccc
gactgctccaacatgtgccacgagtcctcgggtgcggcgctgaccgactcgatcggaatc
ggaaaaggctcggtgaccatcggtgacgtcgagcacgccgacctgatcgtgatcgccgga
caaaaccccggtaccaatcatccccgcatgctgtcggtgctggggaaagcgaaggccaac
ggcgccaagatcatcgccgtgaacccgctgcccgaggccgggttgattcggttcaaagat
ccgcagaaggtgaacggggttgtgggacatggtatcccgatcgccgacgagttcgtgcag
atccgcctcggcggggacatggcattgttcgccgggttaggcaggttgttgttggaggcc
gaggagagggtccccggcagcgttgtcgaccggtcgttcgtcgacaaccattgtgccgga
ttcgacgggtaccgccgccggactctgcaggtcggcttggacaccgtgatggacgccacc
ggcatcgaactcgcgcaacttcagcgggtcgccgcgatgttgatggcgtcgcagcgcacg
gtcatctgctgggctatgggcttgacccaacacgcccacgccgtggccaccatcggtgag
gtcaccaacgtgctgctgctgcggggcatgatcggcaaacccggcgcgggggtgtgcccg
gtgcgcgggcattccaacgtacaaggggaccgcacgatggggatctgggagaagatgccc
gagcagttcctggcggcgctggatcgtgagttcggcattaccagcccccgagcgcacggc
tttgacaccgtggccgcaatccgggccatgcgcgacggtcgggtcagcgtcttcatgggc
atgggcggaaacttcgcgtcggccacccccgacaccgccgtcaccgaggcggccttgcgc
aggtgcgcgctgactgtgcaagtctcgaccaagctcaaccgcagccaccttgtccacggc
gccaccgcgctgatcctgccgacgctgggtcggaccgatcgcgatacccgcaatggtcgc
aaacaattggtgtcggttgaggattcgatgtcgatggtgcatctgtcgcgtggtagcctg
cacccgcccagcgatcaggtgcgcagcgaggtgcagatcatctgccagctggcccgcgcc
ttgttcggccccggacatccggtgccatgggaacggttcgcagatgactacgacaccatc
cgtgacgccatcgccgcggtggtgcccggctgtgacgactacaaccacaaggtgcgtgtg
cccgacggattccaattgccgcacccgccgcgcgatgcgcgcgaattccgtaccagcaca
ggcaaagctaacttcgcggtcaatccgttgcagtgggtgccggtgccgcccggccggctg
gtgctacagaccctacgcagccatgaccagtacaacaccacgatctacgggctcgacgac
cgatatcgcggcgtgaagggcggacgccgggtggtgttcatcaacccggccgacatcgaa
acgttcggtttgacggcgggtgaccgtgtcgacctggtgtcggagtggaccgacggccaa
ggcggtctgcaagaacggcgggcaaaagactttctggtggtggcatattcgacgccggtc
ggcaatgctgcggcctactacccggagaccaatccgctggttccgctcgaccataccgcg
gcccaatcgaacaccccggtgtcgaaggcgatcatcgtgcgattggagccaacggcctag

DBGET integrated database retrieval system