KEGG   Mycobacterium tuberculosis H37Rv: Rv2931Help
Entry
Rv2931            CDS       T00015                                 

Gene name
ppsA
Definition
(RefSeq) phthiocerol synthesis polyketide synthase type I PpsA
  KO
K12440  
phthiocerol/phenolphthiocerol synthesis type-I polyketide synthase A
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Modular PKS
   Rv2931 (ppsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3245445..3251075
Genome map
AA seq 1876 aa AA seqDB search
MTGSISGEADLRHWLIDYLVTNIGCTPDEVDPDLSLADLGVSSRDAVVLSGELSELLGRT
VSPIDFWEHPTINALAAYLAAPEPSPDSDAAVKRGARNSLDEPIAVVGMGCRFPGGISCP
EALWDFLCERRSSISQVPPQRWQPFEGGPPEVAAALARTTRWGSFLPDIDAFDAEFFEIS
PSEADKMDPQQRLLLEVAWEALEHAGIPPGTLRRSATGVFAGACLSEYGAMASADLSQVD
GWSNSGGAMSIIANRLSYFLDLRGPSVAVDTACSSSLVAIHLACQSLRTQDCHLAIAAGV
NLLLSPAVFRGFDQVGALSPTGQCRAFDATADGFVRGEGAGVVVLKRLTDAQRDGDRVLA
VICGSAVNQDGRSNGLMAPNPAAQMAVLRAAYTNAGMQPSEVDYVEAHGTGTLLGDPIEA
RALGTVLGRGRPEDSPLLIGSVKTNLGHTEAAAGIAGFIKTVLAVQHGQIPPNQHFETAN
PHIPFTDLRMKVVDTQTEWPATGHPRRAGVSSFGFGGTNAHVVIEQGQEVRPAPGQGLSP
AVSTLVVAGKTMQRVSATAGMLADWMEGPGADVALADVAHTLNHHRSRQPKFGTVVARDR
TQAIAGLRALAAGQHAPGVVNPADGSPGPGTVFVYSGRGSQWAGMGRQLLADEPAFAAAV
AELEPVFVEQAGFSLHDVLANGEELVGIEQIQLGLIGMQLALTELWCSYGVRPDLVIGHS
MGEVAAAVVAGALTPAEGLRVTATRSRLMAPLSGQGGMALLELDAPTTEALIADFPQVTL
GIYNSPRQTVIAGPTEQIDELIARVRAQNRFASRVNIEVAPHNPAMDALQPAMRSELADL
TPRTPTIGIISTTYADLHTQPVFDAEHWATNMRNPVRFQQAIASAGSGADGAYHTFIEIS
AHPLLTQAIIDTLHSAQPGARYTSLGTLQRDTDDVVTFRTNLNKAHTIHPPHTPHPPEPH
PPIPTTPWQHTRHWITTKYPAGSVGSAPRAGTLLGQHTTVATVSASPPSHLWQARLAPDA
KPYQGGHRFHQVEVVPASVVLHTILSAATELGYSALSEVRFEQPIFADRPRLIQVVADNR
AISLASSPAAGTPSDRWTRHVTAQLSSSPSDSASSLNEHHRANGQPPERAHRDLIPDLAE
LLAMRGIDGLPFSWTVASWTQHSSNLTVAIDLPEALPEGSTGPLLDAAVHLAALSDVADS
RLYVPASIEQISLGDVVTGPRSSVTLNRTAHDDDGITVDVTVAAHGEVPSLSMRSLRYRA
LDFGLDVGRAQPPASTGPVEAYCDATNFVHTIDWQPQTVPDATHPGAEQVTHPGPVAIIG
DDGAALCETLEGAGYQPAVMSDGVSQARYVVYVADSDPAGADETDVDFAVRICTEITGLV
RTLAERDADKPAALWILTRGVHESVAPSALRQSFLWGLAGVIAAEHPELWGGLVDLAIND
DLGEFGPALAELLAKPSKSILVRRDGVVLAPALAPVRGEPARKSLQCRPDAAYLITGGLG
ALGLLMADWLADRGAHRLVLTGRTPLPPRRDWQLDTLDTELRRRIDAIRALEMRGVTVEA
VAADVGCREDVQALLAARDRDGAAPIRGIIHAAGITNDQLVTSMTGDAVRQVMWPKIGGS
QVLHDAFPPGSVDFFYLTASAAGIFGIPGQGSYAAANSYLDALARARRQQGCHTMSLDWV
AWRGLGLAADAQLVSEELARMGSRDITPSEAFTAWEFVDGYDVAQAVVVPMPAPAGADGS
GANAYLLPARNWSVMAATEVRSELEQGLRRIIAAELRVPEKELDTDRPFAELGLNSLMAM
AIRREAEQFVGIELSATMLFNHPTVKSLASYLAKRVAPHDVSQDNQISALSSSAGSVLDS
LFDRIESAPPEAERSV
NT seq 5631 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaagcatcagtggtgaagccgaccttcgccactggctaatcgactacctagta
accaatatcggctgcacacctgacgaggtggaccccgatctgtcgcttgccgacctcggc
gtcagctcccgcgacgcggtcgtactgtccggcgaactgtcagagctgctgggcaggacc
gtatcgccgattgacttctgggagcacccgacgatcaacgcgctggccgcgtatctggcc
gcacccgagccgagccccgactccgacgccgcagtcaagcgtggtgcccggaactcactc
gacgagccaatcgccgtcgtcggcatgggatgtcgtttccctggcgggatttcgtgccca
gaagcattgtgggactttctctgtgaacgccgttcctcgatcagccaggtgccgccgcaa
cgatggcagcccttcgaaggcgggccacccgaggtagccgcggcgctagcgcgcactaca
cggtggggctcatttttgcccgacatcgacgccttcgacgcggaattcttcgagatctcc
cccagcgaagccgacaagatggacccccagcaacgcctgctgctggaagtggcctgggaa
gcgttggagcacgcgggaatcccgcccggcacgctgcgccgctcggcaacaggagtgttt
gccggggcatgcctgagcgaatacggtgcgatggcttccgccgatctgtcgcaggtcgat
ggttggagcaatagcggtggcgcgatgagcatcatcgccaaccgcctctcgtatttcctt
gacctgcgcggcccgtcggtggcggtagacaccgcatgctcgtcgtcgttggtagcgatc
cacctggcctgccagagccttcggacccaggactgtcacctggcaatcgcagccggcgtg
aatttgttgttgtccccggcggtatttcgcggtttcgaccaagtcggcgccttgtccccg
acaggtcagtgccgtgcgttcgatgcgaccgccgacgggtttgtccgcggcgagggtgcc
ggggtagtggtgctcaagcggttgaccgatgcacagcgcgacggggatcgggtgcttgcg
gtgatctgcggttctgcggtcaaccaggacggccgatccaacgggctgatggcccccaac
ccagcggcccagatggcggtgctgcgtgccgcctacaccaacgcggggatgcagcccagc
gaggtcgactacgtcgaagcgcacggaacagggacgctgttgggcgacccgatcgaagcc
cgcgctctcggaacggtgctgggtcgcggccggcccgaggattctccgttgctcatcggc
tctgtcaagaccaacctcggtcacaccgaggctgcggctggaatcgcgggcttcatcaag
acggtgctggctgtgcagcatggccagattccgccaaatcagcacttcgaaaccgcgaac
ccgcacattccctttaccgacttgcggatgaaagtcgttgacacacaaactgaatggccg
gcaacgggccatccccgccgtgccggtgtgtcgtcgttcggcttcggtggcacaaacgcg
cacgtggtgatcgagcagggccaggaggtgcgccccgcgcctggacaaggcttaagtccg
gcggtgtcgaccctggtagtggccggcaagactatgcagcgggtgtccgcgaccgcgggg
atgctagccgattggatggaagggcccggcgctgacgtggccttggccgacgtggcccac
accctcaatcaccaccgatcgcggcaacccaagttcggcacggtggtggcccgtgaccgt
acccaggcgatagccggattgcgtgcgctggccgccggccaacacgcccccggcgtggtc
aaccctgccgacggctcgccggggccgggcaccgtgttcgtctactccggccgcggttca
cagtgggctggcatgggccgtcaattgttggccgacgagccggctttcgcggccgcggtc
gccgaattggaaccggtgtttgtcgagcaagccggcttttcgttgcacgacgtgctggct
aacggcgaggaactggtcggtatcgagcagattcagctcgggttgatcgggatgcagctg
gccctgaccgaattatggtgttcctacggggtgcggcccgacctggtgatcggccactcc
atgggcgaggtggccgccgccgtggtcgccggggcactgaccccggccgagggtctgcgg
gtgaccgccacccggtcacggctgatggcaccgttgtccggccagggcggcatggcactg
ctggaactcgacgcgcccactaccgaggcgttgattgccgacttcccacaggtgacgctc
ggtatttacaactcaccacggcaaacggtgatcgccgggcccaccgagcagatcgatgag
ttgatcgcccgggtgcgcgcgcaaaaccggtttgccagtcgggtcaatatcgaagtggcc
ccgcacaatccggccatggatgctttgcagccggcgatgcgttcggagctggccgatctg
accccacggacccccaccatcggaatcatctccaccacctacgcagacttgcacacccaa
ccggtcttcgacgccgaacactgggccaccaacatgcgcaaccccgtgcgcttccagcag
gccatcgcttccgccggtagcggcgccgacggcgcctaccacaccttcatcgaaatcagc
gcacacccgctgctgacccaggccatcatcgacactctgcacagcgctcaacccggagcc
agatacaccagcctcgggaccctgcaacgcgacaccgacgacgtcgtgaccttccggacc
aacctcaacaaggcccacaccatccacccaccgcacaccccccacccccccgagccacat
ccgcccatccccaccaccccgtggcaacacacccgtcactggatcaccaccaaatatccg
gccggctctgttggatcggccccccgagcgggcacactgctcggccaacacaccaccgtc
gccacggtctcagcgagtccgccctcccacctctggcaagcaaggctggctccggacgcc
aagccgtaccagggcggtcatcgattccaccaagtcgaggtggtcccagcttctgttgtg
ctgcacacaatcctttccgctgcaacagaattgggctactccgcgttgtccgaggtccga
ttcgagcaacccattttcgccgaccggccacgtctaatccaggtcgtcgccgacaaccgg
gcgatcagcctggcctcgagtccggctgccggaacaccctcagaccggtggacgcggcat
gttaccgcacaactttcctcgtcaccgtcggattcggccagcagcttgaacgagcaccat
cgcgccaacgggcagccgcccgaacgtgctcaccgcgacctgattcccgacctggccgag
ctgctcgcaatgcgcggcatcgatggcctgcctttctcatggaccgtcgcgtcgtggaca
cagcactcgagcaacctcacggttgcgatcgatctccccgaagctctgcccgaagggtcg
actgggccgctccttgacgccgcggtgcacctcgccgcgctatcggacgtcgctgattcg
cggctctacgtgccggcaagcatcgagcagatatcgctcggcgatgtcgtcaccgggccg
cgtagctcggtgacgctgaaccgcaccgctcacgacgacgacgggatcaccgtcgatgtc
accgttgcagcccacggcgaagtgccgtccctgtcgatgaggtcgcttcgataccgggct
ctggactttggcctagacgttggtagggcgcaaccgcccgcgtcgaccggtccggtcgag
gcctactgtgatgccaccaatttcgtacacacgatcgactggcaaccgcagaccgttccg
gacgcgacgcacccaggggccgaacaggtaacccatccaggacccgtcgcgataatcggc
gatgacggcgcagcgctgtgtgagaccctcgaaggggcgggctaccagccggccgtgatg
tccgatggggtgtcgcaggcccgctacgtcgtttacgtcgcggattctgatccggctggc
gccgacgagaccgacgtcgacttcgccgtccggatctgtaccgaaatcaccggtctggtg
cggactctcgcggaacgcgatgcggataagcccgcggcgctatggatcctcacccgcgga
gttcacgaatcggtcgccccgtccgcgctgcgccagagtttcctgtggggccttgccggt
gtcatcgccgccgaacatcccgagctgtggggcggactggtcgatctcgcgatcaacgac
gacttaggcgaattcgggccggcacttgccgaactgcttgccaaaccaagcaagtcgatc
ttggtgcgtcgtgacggcgtggtgctcgccccggccttggctcccgtccgtggcgagccg
gcgcgcaagtccttgcagtgcaggcccgacgcggcctacctcatcaccggcggcctgggc
gcccttggcctgctgatggccgattggctcgccgaccgcggcgctcatcgattggtgttg
accggccgcacgccattgccgccacggcgggactggcaactcgacaccctcgacaccgag
ctgcgccggaggatcgacgcgatccgcgccctggaaatgcgcggggtgactgtcgaagcc
gtcgccgccgacgtcggctgccgcgaagacgtgcaggccctgttggccgcgcgcgaccgt
gacggagcggcaccgatccgcgggatcatccacgccgcgggcattaccaacgatcaattg
gtgacgagcatgaccggcgatgcggtgcgacaggttatgtggccgaagatcggcggcagc
caggtcctacacgacgcatttccgcccggcagcgtggacttcttctacttgaccgcctcg
gctgccgggatattcggcattccagggcagggttcctacgccgccgccaattcctacttg
gacgcgctggcgcgggcgcgccggcaacagggctgccacaccatgagcctcgactgggta
gcctggcgggggctcggattggccgcggacgcccagctcgtcagcgaagagctagcgcga
atgggttcgcgtgacatcacgccgtcggaggcattcaccgcttgggaattcgtcgatggc
tacgacgtcgcgcaagcggtcgtggtgcccatgcccgctccggcgggcgccgatggatcc
ggtgcgaacgcttacctattgccggcgcggaactggtcggtgatggcagcgaccgaggtg
cgatccgagctcgaacaggggttacgccgcatcattgcagccgagctgcgagtgcctgag
aaagagctggacaccgaccgcccgttcgccgagttgggtctcaattcccttatggcaatg
gcgattcggcgcgaggccgagcagtttgtcggcatcgagttgtctgccaccatgttgttc
aaccacccaacggtcaaatcactcgccagctaccttgccaaacgtgtggcaccgcacgat
gtgtcacaagacaaccagatttccgcgctatcctcgtcggccggaagtgtgttggacagt
ctattcgatcgcatcgaatcggcgccgcctgaggccgagaggtcggtgtga

DBGET integrated database retrieval system