KEGG   Mycobacterium tuberculosis H37Rv: Rv2939Help
Entry
Rv2939            CDS       T00015                                 

Gene name
papA5
Definition
(RefSeq) phthiocerol/phthiodiolone dimycocerosyl transferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3274949..3276217
Genome map
AA seq 422 aa AA seqDB search
MFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETHPVLASHLEQS
SDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQSVSLLHLQLILREGGAELTL
YLHHCMADGHHGAVLVDELFSRYTDAVTTGDPGPITPQPTPLSMEAVLAQRGIRKQGLSG
AERFMSVMYAYEIPATETPAVLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAV
VAAAILLTEWQLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDI
VDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSFPTMRTPPGLE
IEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPGKSLEAIRSLLCTVPSEYGWI
ME
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccggatctgtgatccgaaagctgtcgcacagcgaggaagtcttcgcgcagtac
gaggtttttacttccatgacaatccagctgcgcggtgttatcgatgtcgatgcgctgtcg
gatgccttcgacgccctcttggaaacccacccagtcctggccagccaccttgagcaaagc
tccgacggcggttggaatctcgttgccgacgacctgctgcactctggaatctgtgtcatc
gacggcacggccgccaccaacgggtcaccgtcgggaaacgccgaactacggctcgaccag
agcgtgtccctattgcatctgcagctgatcctccgcgaaggaggagccgagctgacgcta
tacctccatcactgcatggccgatggtcatcacggggccgttctcgtcgacgagctgttc
tcccgctacaccgacgcggtcactaccggtgaccccggcccgataaccccgcagcccacg
ccgctgtcaatggaggctgtgctggcacagcggggtatcaggaagcaagggctttcggga
gctgaacgttttatgtcggtgatgtatgcctatgagatccctgccaccgagacgccggcg
gtcctcgcgcatcctgggctgccccaagctgttccggtcacccgactctggctttccaag
cagcagacatcggacctcatggcgttcggccgcgagcatcgcctcagccttaacgccgtg
gtcgcggcagccatcctgctgaccgagtggcagctgcgcaacaccccgcacgtcccgatt
ccctacgtttaccccgtcgacctgcgatttgttctagctcccccagtggccccgacagaa
gctaccaatctcctcggggcggcgtcttacctcgctgagatcgggccgaataccgacatc
gtggatctggcaagcgatatcgttgccacacttcgggctgacttggccaatggtgtgatt
cagcagtcggggctccacttcggcacggcattcgaaggaactcctcccggcctaccacca
cttgtcttctgcactgacgccacttcatttcccaccatgcgcacaccgccgggcctggag
atcgaagacattaagggccaattctattgttcgatcagcgtccccctcgatctgtactcg
tgtgccgtttacgcaggacaactgatcatcgagcatcatgggcacatcgcggaaccgggg
aagtccctcgaggcgatacgttcactgctgtgcaccgttccctcggagtatggctggatc
atggagtga

DBGET integrated database retrieval system