KEGG   Mycobacterium tuberculosis H37Rv: Rv2940cHelp
Entry
Rv2940c           CDS       T00015                                 

Gene name
mas
Definition
(RefSeq) multifunctional mycocerosic acid synthase
  KO
K11628  
mycocerosic acid synthase [EC:2.3.1.111]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.111  mycocerosate synthase
     Rv2940c (mas)
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Modular PKS
   Rv2940c (mas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3276380..3282715)
Genome map
AA seq 2111 aa AA seqDB search
MESRVTPVAVIGMGCRLPGGINSPDKLWESLLRGDDLVTEIPPDRWDADDYYDPEPGVPG
RSVSRWGGFLDDVAGFDAEFFGISEREATSIDPQQRLLLETSWEAIEHAGLDPASLAGSS
TAVFTGLTHEDYLVLTTTAGGLASPYVVTGLNNSVASGRIAHTLGLHGPAMTFDTACSSG
LMAVHLACRSLHDGEADLALAGGCAVLLEPHASVAASAQGMLSSTGRCHSFDADADGFVR
SEGCAMVLLKRLPDALRDGNRIFAVVRGTATNQDGRTETLTMPSEDAQVAVYRAALAAAG
VQPETVGVVEAHGTGTPIGDPIEYRSLARVYGAGTPCALGSAKSNMGHSTASAGTVGLIK
AILSLRHGVVPPLLHFNRLPDELSDVETGLFVPQAVTPWPNGNDHTPKRVAVSSFGMSGT
NVHAIVEEAPAEASAPESSPGDAEVGPRLFMLSSTSSDALRQTARQLATWVEEHQDCVAA
SDLAYTLARGRAHRPVRTAVVAANLPELVEGLREVADGDALYDAAVGHGDRGPVWVFSGQ
GSQWAAMGTQLLASEPVFAATIAKLEPVIAAESGFSVTEAITAQQTVTGIDKVQPAVFAV
QVALAATMEQTYGVRPGAVVGHSMGESAAAVVAGALSLEDAARVICRRSKLMTRIAGAGA
MGSVELPAKQVNSELMARGIDDVVVSVVASPQSTVIGGTSDTVRDLIARWEQRDVMAREV
AVDVASHSPQVDPILDDLAAALADIAPMTPKVPYYSATLFDPREQPVCDGAYWVDNLRNT
VQFAAAVQAAMEDGYRVFAELSPHPLLTHAVEQTGRSLDMSVAALAGMRREQPLPHGLRG
LLTELHRAGAALDYSALYPAGRLVDAPLPAWTHARLFIDDDGQEQRAQGACTITVHPLLG
SHVRLTEEPERHVWQGDVGTSVLSWLSDHQVHNVAALPGAAYCEMALAAAAEVFGEAAEV
RDITFEQMLLLDEQTPIDAVASIDAPGVVNFTVETNRDGETTRHATAALRAAEDDCPPPG
YDITALLQAHPHAVNGTAMRESFAERGVTLGAAFGGLTTAHTAEAGAATVLAEVALPASI
RFQQGAYRIHPALLDACFQSVGAGVQAGTATGGLLLPLGVRSLRAYGPTRNARYCYTRLT
KAFNDGTRGGEADLDVLDEHGTVLLAVRGLRMGTGTSERDERDRLVSERLLTLGWQQRAL
PEVGDGEAGSWLLIDTSNAVDTPDMLASTLTDALKSHGPQGTECASLSWSVQDTPPNDQA
GLEKLGSQLRGRDGVVIVYGPRVGDPDEHSLLAGREQVRHLVRITRELAEFEGELPRLFV
VTRQAQIVKPHDSGERANLEQAGLRGLLRVISSEHPMLRTTLIDVDEHTDVERVAQQLLS
GSEEDETAWRNGDWYVARLTPSPLGHEERRTAVLDPDHDGMRVQVRRPGDLQTLEFVASD
RVPPGPGQIEVAVSMSSINFADVLIAFGRFPIIDDREPQLGMDFVGVVTAVGEGVTGHQV
GDRVGGFSEGGCWRTFLTCDANLAVTLPPGLTDEQAITAATAHATAWYGLNDLAQIKAGD
KVLIHSATGGVGQAAISIARAKGAEIFATAGNPAKRAMLRDMGVEHVYDSRSVEFAEQIR
RDTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEIGKADVYGNTRLGLFPFRRGLTFYY
LDLALMSVTQPDRVRELLATVFKLTADGVLTAPQCTHYPLAEAADAIRAMSNAEHTGKLV
LDVPRSGRRSVAVTPEQAPLYRRDGSYIITGGLGGLGLFFASKLAAAGCGRIVLTARSQP
NPKARQTIEGLRAAGADIVVECGNIAEPDTADRLVSAATATGLPLRGVLHSAAVVEDATL
TNITDELIDRDWSPKVFGSWNLHRATLGQPLDWFCLFSSGAALLGSPGQGAYAAANSWVD
VFAHWRRAQGLPVSAIAWGAWGEVGRATFLAEGGEIMITPEEGAYAFETLVRHDRAYSGY
IPILGAPWLADLVRRSPWGEMFASTGQRSRGPSKFRMELLSLPQDEWAGRLRRLLVEQAS
VILRRTIDADRSFIEYGLDSLGMLEMRTHVETETGIRLTPKVIATNNTARALAQYLADTL
AEEQAAAPAAS
NT seq 6336 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacgtgtcactcccgttgcggtgatcgggatgggatgtcggcttcctgggggg
atcaactcgcccgacaaactgtgggagtcgttgctgcgcggtgatgacttggtcaccgag
attccgcccgaccgctgggacgccgacgactattacgaccctgagccaggggttcccggg
cggtcggtgtcccggtggggtgggttccttgacgacgtcgccggtttcgatgctgagttc
ttcgggattagcgagcgggaagcgacctcgatcgatccgcagcagcggctactgctggaa
acgtcgtgggaggcgatcgagcatgctggtctggatccggcgtcgttggccgggtcctcg
acggccgtttttactgggctgacccacgaggactacctggtactcaccacaacggcgggc
ggtttggccagtccatatgtggttaccggcctcaacaacagtgtggcgtcagggcggatc
gcgcacacattgggtctacatggtccggcgatgacgtttgacaccgcgtgttcttcgggt
ctgatggcggtgcacctggcctgccgcagcctgcatgacggcgaagctgacctcgctttg
gcgggcggttgtgcggtgctgctggagccgcatgccagtgtggcggcgtctgcgcagggc
atgctgtcgtcaaccggtcggtgccattcattcgatgctgacgcggatgggtttgtgcgt
tccgagggctgcgcgatggtgttgctgaagcgactgccggatgcgctgcgcgacggtaat
cggatcttcgccgtggtgcgtggcacggccaccaatcaggacggccgcacggagacgctc
accatgccgtccgaggacgcccaggttgccgtgtaccgtgcggcgttggcggcggcgggc
gtgcagcccgaaacggtcggtgtggtcgaggcgcacggcaccggtacgccaatcggcgac
ccgattgagtaccgcagcctggcgcgggtgtatggcgcgggcaccccctgcgcgcttgga
tcggccaagagcaacatggggcacagcacggcatcggcggggaccgtcgggctgatcaag
gcaattctgtcactgcggcacggggtggtgccgccgctgctgcatttcaatcggctgccc
gatgagctttccgacgtcgagaccgggctctttgtgccgcaagcggttacgccgtggccc
aacggtaatgatcacacaccgaagcgggtcgcggtgtcctcgttcgggatgtccgggacc
aacgtgcatgccatcgtggaagaggccccagcagaagcttccgcacccgagagttcaccg
ggcgacgctgaggtgggcccgcggctattcatgctgtcgtccacgtccagcgacgcactg
cgccagacggcccgccaactagccacctgggtggaagaacaccaggactgcgtggcggcc
tcggatctggcctacacgctggcgcgtggccgcgcgcaccggccggtgcgcaccgcggtg
gttgccgccaacctgccggagctcgtcgagggtttgcgcgaggtggccgacggtgacgcc
ctctatgacgcggcggtgggacacggtgatcgaggaccggtctgggtcttctccgggcaa
gggtcgcagtgggcggcgatgggcacgcaattgctcgccagcgaaccagtgttcgcggcc
accatcgccaagctggagccggtgatcgccgcagaatcgggattctcggtgaccgaggcg
ataacggcgcagcagaccgtgaccggaatcgacaaagtgcagccggcagtgttcgccgtt
caggtcgcgttggccgccaccatggagcaaacctacggagtgcggccgggcgcggtcgtc
ggacactcgatgggtgagtcggccgcggccgtcgtcgcgggggcactgtcgctcgaggac
gcggcgcgcgtcatttgccgccgctcgaagctgatgacccgcatagccggtgctggtgcc
atgggctcggtggaattgcccgccaagcaagtgaattcggagctgatggcacgcggaatc
gacgatgttgtggtctcggtggtggcgtccccgcaatccacggtgatcggcggtacgagc
gacaccgttcgtgacctcatcgcccgttgggagcagcgggacgtgatggcgcgcgaggtg
gccgtcgacgtggcgtcgcactcgcctcaagtcgatccgatactcgacgatttggccgcg
gcgctggcggacattgctccgatgacgcccaaggtgccgtactactcggcgaccctgttc
gacccgcgcgagcagccggtgtgcgatggcgcttactgggtggacaatctgcgcaacacg
gtgcagttcgccgcggcggtgcaggctgcgatggaggacggctaccgggtcttcgcggag
ctgtcgccccacccgctgcttacccacgccgtcgaacagacgggccgaagcctcgacatg
tcggtcgccgccctggccggcatgcggcgagagcagcctctgccgcatggtctgcgcggc
ttgctgacggagctgcaccgcgcgggcgccgctttggactattcggcgctgtatcccgct
gggcggctggtggatgcgccgctgccggcgtggacccacgcccgcctattcatcgacgat
gatgggcaagaacagcgggcacaaggtgcctgcaccatcaccgtgcatccgttgcttggc
tcgcatgtgcggctgactgaggaacctgagcgccacgtctggcagggcgacgttggcacc
tcggtgctgtcctggctcagcgatcatcaggtgcataacgttgccgcccttcccggcgcc
gcctactgcgagatggctttggctgcggccgctgaggtcttcggcgaagcggctgaggtt
cgcgacatcacctttgagcagatgttgttgctcgacgagcagaccccgatcgacgccgtc
gcatcgatcgacgcgcctggtgtcgtcaacttcaccgtggagaccaaccgggacggtgaa
accacccggcatgccaccgcggcgctgcgcgccgccgaagatgactgcccgccgccgggg
tacgacatcaccgctctgctgcaggcgcatccgcacgccgtgaacgggaccgccatgcgg
gaatcgttcgccgagcgtggtgttactttgggcgccgcgttcggtggtctgaccaccgcg
cataccgccgaggcgggagccgcgacggtgctggccgaggtcgcgctgcccgcgtcgatc
cggttccagcagggcgcctaccgaatccacccggcgctgctggacgcttgtttccagtcg
gtcggcgcgggcgtccaggccggtacggccactggtggcctgctgttgccgttgggtgtg
cgcagcctgcgtgcctacgggcctacccgcaatgcccgctactgctacacgcggttgacc
aaggccttcaacgacgggacccgaggtggtgaggccgacctcgacgtgctggacgagcac
gggaccgtcctgttggccgtgcgtgggctacgcatgggaaccgggacctccgaacgcgac
gagcgtgaccgcctagtcagcgagcggctactgaccctcggatggcagcagcgagcgctg
cccgaggttggcgacggcgaggctggatcgtggctattgatcgacacttccaacgccgtc
gacacccccgacatgttggcttccacgttgacggacgcgctgaagtcccacggcccccaa
ggcaccgaatgcgccagcctgtcctggtcggtccaggacaccccgcccaacgatcaagct
ggcctcgaaaagctgggcagccagctgcgtggccgcgatggtgtggtgatcgtgtatggg
cctcgcgtcggcgaccccgatgagcacagtctgctggccggtcgtgaacaggtccgtcac
ctggttcggatcacccgggaactggctgaattcgagggcgagctgccgcgcttgttcgtg
gtgaccagacaagcccagatagtgaagccgcacgactcgggagaaagagccaacctggag
caggccggcctgcgtggtctgctacgggtgatcagcagtgaacatccgatgctgcgcacc
accttgatcgatgtggacgaacacacggacgttgagcgggtggcccagcagctgctgagc
ggatcggaagaggacgagacggcctggcggaatggcgactggtatgtggcccgcttgacc
cccagtccgctgggccatgaagagcggcgcaccgcggtcttggatcccgaccacgacggt
atgcgggtgcaggtccgcaggccgggagacttgcaaacgttggaattcgttgcgagtgac
cgagttccgcccggccccgggcaaatcgaagtcgcggtcagcatgtccagcatcaacttc
gccgacgttttgatcgcgtttggacgattccccattatcgatgaccgcgagccgcagttg
ggtatggatttcgtcggtgtggtgactgcggtcggggaaggtgtcaccggtcaccaggtc
ggtgatcgtgttggcggtttctccgaaggtggctgttggcggacgttcctcacctgtgac
gccaacctcgcggtcacgctgccgcccggcttgaccgatgagcaggcgatcacggcggcc
accgcgcatgccaccgcctggtatgggctcaacgacctggctcagatcaaggccggtgac
aaagtgttgattcactccgccaccggcggtgtggggcaggcggccatatcgattgcccgc
gccaagggagcggagattttcgcgaccgccggcaatcccgcgaagcgagccatgctgcgc
gacatgggcgtcgagcatgtctacgattcgcgcagcgtcgagttcgccgagcagatccgg
cgcgacaccgacgggtacggcgtggatatcgtgctgaactcgctgaccggcgccgcccaa
cgtgcggggctggagttgttggccttcggcggacgcttcgtcgaaatcggcaaggccgac
gtttacggcaacacccggctggggctgttcccgttccgtcgcggactgaccttctactac
ttggacctcgcgctgatgtcggtcacccagcccgaccgggtccgtgagttgctggccacg
gtgttcaagctcaccgcagacggggtgctgaccgcaccgcaatgcactcattacccgttg
gccgaggcggccgacgccatccgggcaatgagcaacgccgagcacaccggcaaactcgtg
ctcgacgtaccgcgtagcggccgtagaagcgtggcggtcaccccggagcaagctccgctg
taccgccgcgacggctcctacatcatcaccggcggcctgggtggcctcggcctgttcttc
gcctcgaagctggccgcggcgggctgtggccggatcgtgctgaccgcacgttcccagccc
aaccccaaagcgcggcagaccatcgaaggcctgcgcgcggctggggccgacatcgtggtg
gagtgtggcaacatcgccgaacccgacacggcggaccggctggtgagtgcggcgaccgct
accgggcttccgctgcgcggtgtgctgcactcggcggcggtggtcgaggatgccacgctg
accaacatcaccgatgagctcatcgatcgcgactggtcgcccaaggtgttcggatcctgg
aacctacaccgcgccaccctcggtcagccgctggactggttctgcttgttctcctcggga
gcggcattgctcggctcgccgggtcagggcgcctacgcggcggccaacagctgggtcgac
gtcttcgcgcactggcgccgcgcccagggcctgccggtcagcgcgattgcgtggggtgcg
tggggcgaggtcggccgcgccacgttcttggccgaggggggcgaaatcatgatcaccccg
gaggaaggtgcgtatgccttcgagacgctcgtgcgccacgaccgcgcctacagcggttac
attccgatcctcggggcgccatggctggccgaccttgtccgacgcagcccgtggggtgaa
atgttcgcatccactgggcagcggtcaaggggcccaagcaaattccgcatggagctcctt
tcgctgccgcaagatgaatgggccggccggctacggcgtctgctggttgagcaggccagt
gtgatcctgcgtcgcacgatcgacgctgaccgctcattcatcgagtacggcctggattcg
ctgggcatgctcgagatgcgtacccacgttgaaaccgagaccgggatacgcctgaccccc
aaggtcatcgccacaaacaacaccgcccgcgctttggcccagtacttggcggacacgctg
gccgaggagcaggcggcggcaccggcggcatcatag

DBGET integrated database retrieval system