KEGG   Mycobacterium tuberculosis H37Rv: Rv2941Help
Entry
Rv2941            CDS       T00015                                 

Gene name
fadD28
Definition
(RefSeq) long-chain-fatty-acid--AMP ligase FadD28
  KO
K12427  
mycocerosic acid adenylyltransferase [EC:2.7.7.95]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rv2941 (fadD28)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
3283335..3285077
Genome map
AA seq 580 aa AA seqDB search
MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLNVAQELSRCGS
TGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVTDERSDSVLSDSSPVAILTTS
SAVDDVVQHVARRPGESPPSIIEVDLLDLDAPNGYTFKEDEYPSTAYLQYTSGSTRTPAG
VVMSHQNVRVNFEQLMSGYFADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAV
LTSPVSFLQRPARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETVDFDTESLSAG
HAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTVGEIWVHGDNVANGYWQKPDE
SERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDGKMFIIGRIKDLLIVYGRNHSPDDIEAT
IQEITRGRCAAISVPGDRSTEKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGL
SVADLVLVAPGSIPITTSGKVRRGACVEQYRQDQFARLDA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcgttcccttcccgctgcgttgcgcgcgtgtgcgcgtctgcaaccccatgac
ccggccttcacgtttatggattacgaacaggactgggacggcgttgcgataaccctgacg
tggtcgcagctgtatcggcgaacgctgaatgtggcacaggagctgagccgttgtggttcc
acgggtgaccgcgtggtgatctctgctccgcagggactcgagtacgtcgtcgcctttctc
ggcgcgttgcaggccgggcgcatcgccgtgccgctttcggttccacaaggcggcgttacc
gatgaacgttccgattcggtactgagtgattcgtcgccggtggccattctcactacatcg
tctgccgtggacgacgtcgtgcaacatgttgcgcggcggcccggggaatccccgccatca
attatcgaagttgatttgctcgatctggacgctccgaatgggtataccttcaaagaagac
gagtatccatctaccgcgtatttgcaatacacctccgggtccacccgcacgcccgctggc
gtggtgatgtcccatcagaacgttcgggttaatttcgaacagctgatgtctggctacttt
gcggataccgacgggattccaccgccaaattccgcactcgtatcctggctacccttctac
cacgacatgggtttggtaataggaatttgcgcaccaattctgggtggataccccgcggtg
ctcaccagcccggtgtcgttcctgcagcgcccggcccggtggatgcacttgatggccagc
gattttcacgccttttcggcagcaccgaatttcgcctttgaactagcggcacgaagaaca
accgacgacgacatggccgggcgtgacctcggcaacatactgaccatcctcagcggtagc
gagcgggtacaggccgcgacgatcaagcgcttcgccgaccgctttgctcgcttcaatctg
caggagagggtgatccggccttcatacgggctcgcagaagcaacggtgtacgtggcgacg
agcaaaccgggtcaaccaccggagaccgtcgacttcgatactgaaagtttatccgccggc
catgcgaagccgtgcgcaggcggcggcgctacatcgttgatcagctacatgttgccgcgg
tcaccgatcgtgcggatcgtcgactcggacacctgcatcgaatgtccggacggaaccgtc
ggcgagatctgggtgcacggcgacaacgtcgctaatggctattggcaaaaacccgacgag
agtgagcgcacgttcggcggaaagattgtcaccccttcgccgggcacacccgaaggtcct
tggctaagaacgggcgactcaggtttcgtcaccgatggcaaaatgttcatcatcggtcgg
atcaaagatctcctaattgtgtacggacgcaaccactcccccgacgacatcgaggcaacg
atccaggagatcacccgcgggcgctgcgcggcgatctcggttcccggtgaccgcagcacc
gaaaagctggtcgccattatcgaactcaagaagcgtggcgactcagatcaggacgcgatg
gctagactgggcgctattaaacgcgaagtcacgtcggctttatcgagttcgcacggtctc
agcgtcgcggatctggttctggttgcgcctggctcgatccccattaccaccagcgggaag
gtcaggagaggggcgtgtgtcgagcaatatcgacaggatcaattcgcccgcttggatgcc
tag

DBGET integrated database retrieval system