KEGG   Mycobacterium tuberculosis H37Rv: Rv2942Help
Entry
Rv2942            CDS       T00015                                 

Gene name
mmpL7
Definition
(RefSeq) transmembrane transport protein MmpL7
  KO
K06994  
putative drug exporter of the RND superfamily
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3285070..3287832
Genome map
AA seq 920 aa AA seqDB search
MPSPAGRLHRIRYIRLKKSSPDCRATITSGSADGQRRSPRLTNLLVVAAWVAAAVIANLL
LTFTQAEPHDTSPALLPQDAKTAAATSRIAQAFPGTGSNAIAYLVVEGGSTLEPQDQPYY
DAAVGALRADTRHVGSVLDWWSDPVTAPLGTSPDGRSATAMVWLRGEAGTTQAAESLDAV
RSVLRQLPPSEGLRASIVVPAITNDMPMQITAWQSATIVTVAAVIAVLLLLRARLSVRAA
AIVLLTADLSLAVAWPLAAVVRGHDWGTDSVFSWTLAAVLTIGTITAATMLAARLGSDAG
HSAAPTYRDSLPAFALPGACVAIFTGPLLLARTPALHGVGTAGLGVFVALAASLTVLPAL
IALAGASRQLPAPTTGAGWTGRLSLPVSSASALGTAAVLAICMLPIIGMRWGVAENPTRQ
GGAQVLPGNALPDVVVIKSARDLRDPAALIAINQVSHRLVEVPGVRKVESAAWPAGVPWT
DASLSSAAGRLADQLGQQAGSFVPAVTAIKSMKSIIEQMSGAVDQLDSTVNVTLAGARQA
QQYLDPMLAAARNLKNKTTELSEYLETIHTWIVGFTNCPDDVLCTAMRKVIEPYDIVVTG
MNELSTGADRISAISTQTMSALSSAPRMVAQMRSALAQVRSFVPKLETTIQDAMPQIAQA
SAMLKNLSADFADTGEGGFHLSRKDLADPSYRHVRESMFSSDGTATRLFLYSDGQLDLAA
AARAQQLEIAAGKAMKYGSLVDSQVTVGGAAQIAAAVRDALIHDAVLLAVILLTVVALAS
MWRGAVHGAAVGVGVLASYLAALGVSIALWQHLLDRELNALVPLVSFAVLASCGVPYLVA
GIKAGRIADEATGARSKGAVSGRGAVAPLAALGGVFGAGLVLVSGGSFSVLSQIGTVVVL
GLGVLITVQRAWLPTTPGRR
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtccggctggccgtctacacagaattcggtatatccgtttgaaaaagtcctcc
ccggactgccgcgccaccatcaccagcgggtcagccgacggtcagcgaaggtcaccccgg
ctcaccaacctgctcgtcgtcgccgcctgggttgccgcggcggtgatcgcaaatctgctt
ctcacgttcacgcaagcagaaccgcacgacaccagcccggcgctgctgccacaagatgcc
aagacagccgccgccaccagccggattgcgcaggctttccccggcaccggtagcaacgct
atcgcctatctcgtcgtggaaggcggcagcacgcttgagccgcaggaccagccttactac
gacgccgccgtcggtgccctgcgcgccgacacccgccacgtgggatccgtcctcgactgg
tggtcagatcccgtcaccgccccgctgggaaccagccccgacggccgctccgctacggcc
atggtgtggctgcggggcgaggcgggcaccacccaagctgccgaatccctcgatgccgtc
cgatcggtgctgcgccagttaccgcccagtgaggggcttcgcgccagcatcgtggtcccg
gcaatcaccaacgacatgccgatgcagataaccgcctggcagagcgcgacgatcgtgacc
gttgcggcggtgatcgccgtcctactgctgctgcgggcgcgcctgtcggtgcgggccgcg
gcgatcgtgctgctgaccgcggacttgtcgcttgcggtggcctggccgctggccgcggtg
gtgcggggacacgattggggaaccgattcggtattttcttggacgctggccgcggtcctg
acgatcggaaccatcaccgcagccaccatgctggccgcgcggctcgggtccgacgcaggt
cattcggccgcgcccacataccgcgacagcctgcccgcgttcgccctgcccggggcgtgt
gtcgccatattcaccggcccgctgctgctggcccgaaccccagcgctgcacggagttggc
actgccgggctaggtgtctttgtggcacttgcggcttcgttgacggtgctgcctgccctg
atcgcgcttgccggagcgtcacggcagttaccggcaccaaccacgggtgccggctggaca
ggccggttgtcgctacccgtctcttctgcttcggccctgggcacagcggcagtgctggcg
atctgcatgctacccatcatcgggatgcggtggggtgtggccgagaacccgacaaggcaa
ggcggcgcacaagtccttccggggaatgcgcttcccgatgtggtggtgatcaaatccgct
cgggacctgagggacccagccgcgctcatcgccatcaaccaggtcagccaccgtctggtg
gaggttcccggtgtgcgcaaggtggagtcggcggcatggccggccggtgtcccgtggacc
gacgcctcgctcagttccgcggccggcaggctcgccgaccagctgggtcagcaggccgga
tcgttcgtgccggcggtgactgcgatcaaatcgatgaagtccataatcgaacagatgagc
ggcgcggtcgaccaactggacagcaccgtgaacgtgactctcgccggggcaaggcaagca
cagcaatacctcgatcccatgctcgccgccgcgcggaacctcaaaaacaaaaccaccgaa
ctgtcggaatacctggaaacgatccacacctggattgtcggcttcacaaactgccccgac
gacgtcctgtgcacggccatgcgcaaggtcattgaaccctacgacatcgtggtcaccggc
atgaacgagctgtccactggcgccgaccgcatctccgcgatatcgacacagacaatgagc
gcgttgtcctcggcaccgcggatggtggcgcagatgcggtcggcgctagcacaggtgcgc
tcgttcgtacccaagctggaaacaaccatccaggacgccatgccgcaaatagcgcaggcg
tcggcgatgctgaagaatctcagcgccgatttcgccgataccggtgagggcggcttccac
ctgtccaggaaggacctggcggacccgtcgtaccggcacgtacgggaatcgatgttctcg
tcagacggaaccgccacccggctgttcctctattctgacggacaactggaccttgctgcg
gcagcacgcgcgcagcagctcgagatcgccgcgggcaaggcgatgaaatacggaagcctg
gtcgacagccaggtcacggtgggtggggccgcgcaaatagccgcggctgtccgcgatgcc
ctcatccacgatgctgtgctactggccgttatcttgctcacggtagtggctctggccagc
atgtggcgcggtgccgtccacggtgctgcggttggcgtgggtgtgctggcctcttacctc
gccgccctgggggtctcgattgcactgtggcaacacctactggatcgcgagctcaacgcc
ttggtcccgctggtgtcgttcgccgtcctcgcttcgtgcggcgtcccgtatctcgttgcc
ggcatcaaagccggtcgtatcgccgacgaggcaacgggtgcgcggtccaagggggcggta
tccgggcggggagcggttgcgccgcttgcggcgctcggtggcgtattcggcgctggcctg
gtgctggtgtcgggaggttccttcagcgtgctcagtcagattggcacggttgttgtgctc
ggtctgggcgtgctgatcacggtgcagcgagcgtggcttccgaccacgccagggcggcgt
tga

DBGET integrated database retrieval system