KEGG   Mycobacterium tuberculosis H37Rv: Rv2947cHelp
Entry
Rv2947c           CDS       T00015                                 

Gene name
pks15
Definition
(RefSeq) polyketide synthase
  KO
K12430  4-hydroxyphenylalkanoate synthase [EC:2.3.1.261]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.261  (4-hydroxyphenyl)alkanoate synthase
     Rv2947c (pks15)
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Modular PKS
   Rv2947c (pks15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc Thiolase_N Docking
Motif
Other DBs
NCBI-GeneID: 887291
NCBI-ProteinID: NP_217463
TubercuList: Rv2947c
UniProt: P96284 I6XFR2
Position
complement(3296350..3297840)
Genome map
AA seq 496 aa AA seqDB search
MIEEQRTMSVEGADQQSEKLFHYLKKVAVELDETRARLREYEQRATEPVAVVGIGCRFPG
GVDGPDGLWDVVSAGRDVVSEFPTDRGWDVEGLYDPDPDAEGKTYTRWGAFLDDATGFDA
GFFGIAPSEVLAMDPQQRLMLEVSWEALEHAGIDPLSLRGSATGVYTGIFAASYGNRDTG
GLQGYGLTGTSISVASGRVSYVLGLQGPAVSVDTACSSSLVAIHWAMSSLRSGECDLALA
GGVTVMGLPSIFVGFSRQRGLAADGRCKAFAAAADGTGWGEGAGVVVLERLSDARRLGHS
VLAVVRGSAVNQDGASNGLTAPNGLAQQRVIQVALANAGLSAADVDVVEAHGTATTLGDP
IEAQALLSTYGQGGPAEQPLWVGSIKSNMGHTQAAAGVAGVIKMVQAMRHGVMPATLHVD
EPSPRVDWTSGAVSVLTEAREWSVDGRPRRAAVSSFGISGTNAHLILEEAPVPAPAEAPV
EASESTGGRGRRWCRG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaggagcaacggacgatgagcgttgaaggtgccgaccagcagagcgaaaagctt
tttcactacctaaagaaggttgctgtcgagctcgatgagacacgcgctcggctgcgtgaa
tatgagcaacgcgcgacagaaccggtggcggtggtgggaatcggctgccgatttccgggc
ggcgtggatggcccggacggactctgggatgtcgtttcggcggggcgcgacgtggtgtcg
gagtttccgaccgatcggggctgggatgttgaggggctatacgatccggatcccgacgct
gagggcaaaacctacacgcgatggggggcatttctagacgacgccaccggctttgacgcc
gggttcttcggcatcgctcctagtgaagtgttggcgatggatcctcagcagcggttgatg
ctggaggtttcgtgggaggcgttggagcacgcggggattgacccgttgtcgttgcgtggt
tcggcgaccggggtgtacaccggcattttcgcggcgagttacggcaatagggataccggg
gggctgcaagggtacgggttgaccggcacgtcaatcagcgtggcctcgggacgtgtgtcg
tacgtattggggctgcagggcccggcggtgtcagtggataccgcttgttcgtcgtcgttg
gtggcgatccattgggcgatgtcgtcattgcgctccggggagtgtgatttggcgttggcc
ggtggggtgacggtgatggggctgccgtcgatttttgtggggttttcccggcagcggggg
ttggctgccgatgggcgatgtaaggcgtttgcggccgcggccgacggcaccgggtggggc
gagggcgccggggtggttgtgctggagcggctatcggacgcccggcggttggggcattcg
gtgctggcggtggtgcgggggagcgcggtcaaccaggatggtgcgtccaatgggctgacc
gcgcccaatgggctcgcccagcagcgagtgatccaggtggcgttggccaacgccgggttg
tccgccgcagacgtagacgtggtggaggcacacgggaccgccaccacgttgggtgatccc
atcgaagcgcaggcattgctgtccacctacgggcagggaggtccagcggagcagccgctg
tgggtgggctcaatcaagtcgaacatgggccacacccaggccgccgcgggggtcgccggg
gtgatcaagatggtgcaggcgatgcgtcatggggtgatgccggcgacgttgcatgtggat
gagccttccccgcgggtggattggaccagcggcgcggtgtcggtgttgaccgaggccagg
gagtggtcggttgacgggcgtccgcgccgggcggcggtgtcctcctttgggatcagcggc
accaacgcgcatctgatcttggaagaggcccccgtaccagcccccgcagaggcgccggtt
gaggcgagcgaaagcaccgggggccgcggccgtcgatggtgccgtgggtga

DBGET integrated database retrieval system