KEGG   Mycobacterium tuberculosis H37Rv: Rv2951cHelp
Entry
Rv2951c           CDS       T00015                                 

Definition
(RefSeq) phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase
  KO
K14728  
phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase [EC:1.2.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.-  Acting on the aldehyde or oxo group of donors
    1.2.-.-  
     Rv2951c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3303103..3304248)
Genome map
AA seq 381 aa AA seqDB search
MGGLRFGFVDALVHSRLPPTLPARSSMAAATVMGADSYWVGDHLNALVPRSIATSEYLGI
AAKFVPKIDANYEPWTMLGNLAFGLPSRLRLGVCVTDAGRRNPAVTAQAAATLHLLTRGR
AILGIGVGEREGNEPYGVEWTKPVARFEEALATIRALWNSNGELISRESPYFPLHNALFD
LPPYRGKWPEIWVAAHGPRMLRATGRYADAWIPIVVVRPSDYSRALEAVRSAASDAGRDP
MSITPAAVRGIITGRNRDDVEEALESVVVKMTALGVPGEAWARHGVEHPMGADFSGVQDI
IPQTMDKQTVLSYAAKVPAALMKEVVFSGTPDEVIDQVAEWRDHGLRYVVLINGSLVNPS
LRKTVTAVLPHAKVLRGLKKL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggacttcgtttcggttttgttgatgccctcgtgcactcgcggttgccgccgacc
ctgccggcacggtctagcatggcggccgccaccgtgatgggcgccgactcgtattgggtc
ggcgaccatctgaatgcgctggtgccgcgctcgattgcgacttccgaatatctcggaatt
gcggcgaaattcgtgcccaagatcgatgccaattacgaaccgtggacgatgcttggaaac
ctcgccttcgggttgcccagccgtctgcgactgggcgtgtgcgtgaccgatgcaggtcgg
cgcaatccagcggtcacagcccaggctgccgcgactttgcacttgcttacccgaggccga
gccatattgggtatcggtgtcggggaacgtgaaggcaacgagccctacggtgtggagtgg
accaaaccggtggcgcggttcgaagaagccctggccaccattcgcgcgttgtggaattca
aacggggagcttatctcacgtgaatcgccatactttccgttacataacgccttgttcgac
cttccgccataccgtgggaaatggcccgaaatctgggtcgcggcccacgggccgcggatg
ttacgggccaccggacgttacgccgatgcctggattcccattgttgtggttcgtcccagc
gactacagtcgcgcactcgaagcggtgcgcagcgcggcgtccgatgccggacgcgaccca
atgtcgattactccggcggcggtgcgcggcatcatcactggacggaatcgcgacgacgtg
gaagaggcgctggaatctgtcgttgtgaagatgaccgcgctcggggtacctggggaagcc
tgggcgcgtcacggcgtcgagcatccaatgggagccgacttctccggtgtgcaggacatc
atcccgcaaaccatggacaaacagacggttttgtcctacgcggccaaggtcccggctgcg
cttatgaaagaagtcgtcttcagtggaacccctgacgaagtcatcgatcaagtagcggaa
tggcgagatcacgggctgcgctacgttgtgctgatcaacggcagtttggttaaccccagc
ctgcgcaagacggtgacggctgtcctgccgcacgccaaggttttgcgcgggctcaagaag
ctatga

DBGET integrated database retrieval system