KEGG   Mycobacterium tuberculosis H37Rv: Rv2957Help
Entry
Rv2957            CDS       T00015                                 

Definition
(RefSeq) PGL/p-HBAD biosynthesis glycosyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3309470..3310297
Genome map
AA seq 275 aa AA seqDB search
MVQTKRYAGLTAANTKKVAMAAPMFSIIIPTLNVAAVLPACLDSIARQTCGDFELVLVDG
GSTDETLDIANIFAPNLGERLIIHRDTDQGVYDAMNRGVDLATGTWLLFLGADDSLYEAD
TLARVAAFIGEHEPSDLVYGDVIMRSTNFRWGGAFDLDRLLFKRNICHQAIFYRRGLFGT
IGPYNLRYRVLADWDFNIRCFSNPALVTRYMHVVVASYNEFGGLSNTIVDKEFLKRLPMS
TRLGIRLVIVLVRRWPKVISRAMVMRTVISWRRRR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagacgaaacgatacgccggcttgaccgcagctaacacaaagaaagtcgccatg
gccgcaccaatgttttcgatcatcatccccaccttgaacgtggctgcggtattgcctgcc
tgcctcgacagcatcgcccgtcagacctgcggtgacttcgagctggtactggtcgacggc
ggctcgacggacgaaaccctcgacatcgccaacattttcgcccccaacctcggcgagcgg
ttgatcattcatcgcgacaccgaccagggcgtctacgacgccatgaaccgcggcgtggac
ctggccaccggaacgtggttgctctttctgggcgcggacgacagcctgtacgaggctgac
accctggcgcgggtggccgccttcattggcgaacacgagcccagcgatctggtatatggc
gacgtgatcatgcgctcaaccaatttccgctggggtggcgccttcgacctcgaccgtctg
ttgttcaagcgcaacatctgccatcaggcgatcttctaccgccgcggactcttcggcacc
atcggtccctacaacctccgctaccgggtcctggccgactgggacttcaatattcgctgc
ttttccaacccagcgctcgtcacccgctacatgcacgtggtcgttgcaagctacaacgaa
ttcggcgggctcagcaatacgatcgtcgacaaggagtttttgaagcggctgccgatgtcc
acgagactcggcataaggctggtcatagttctggtgcgcaggtggccaaaggtgatcagc
agggccatggtaatgcgcaccgtcatttcttggcggcgccgacgttag

DBGET integrated database retrieval system