KEGG   Mycobacterium tuberculosis H37Rv: Rv2958cHelp
Entry
Rv2958c           CDS       T00015                                 

Definition
(RefSeq) PGL/p-HBAD biosynthesis glycosyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3310714..3312000)
Genome map
AA seq 428 aa AA seqDB search
MEETSVAGDPGPDAGTSTAPNAAPEPVARRQRILFVGEAATLAHVVRPFVLARSLDPSRY
EVHFACDPRFNKLLGPLPFPHHPIHTVPSEEVLLKIAQGRLFYNTRTLRKYIAADRKILN
EIAPDVVVGDNRLSLSVSARLAGIPYIAIANAYWSPQARRRFPLPDVPWTRFFGVRPVSI
LYRLYRPLIFALYCLPLNWLRRKHGLSSLGWDLCRIFTDGDYTLYADVPELVPTYNLPAN
HRYLGPVLWSPDVKPPTWWHSLPTDRPIIYATLGSSGGKNLLQVVLNALADLPVTVIAAT
AGRNHLKNVPANAFVADYLPGEAAAARSAVVLCNGGSPTTQQALAAGVPVIGLPSNMDQH
LNMEALERAGAGVLLRTERLNTEGVAAAVKQVLSGAEFRQAARRLAEAFGPDFAGFPQHI
ESALRLVC
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaacaagcgtcgccggcgacccgggaccggacgctgggacgagcacggcgccc
aacgccgcaccggagcctgtcgctcgcaggcaacggatcctgtttgtaggggaggccgcg
accctggcccacgtcgtccggccgttcgtgttggcgcggtcgctggacccgagtcgttat
gaggtccactttgcctgcgacccgcggttcaataagcttttgggcccgctcccgttccca
catcacccgattcacaccgtccccagcgaggaggttctccttaaaatcgctcagggccgc
ctcttctacaacacgcggacgttgcgcaaatacatcgcggctgacaggaagatcctgaac
gagatcgcaccggacgtagtcgtcggtgacaaccgtctttcgctctcggtcagcgcccga
ctagccggcattccgtacatcgccatcgcgaacgcctactggagtcctcaggcccgccgt
cggtttccgctgccagacgtgccgtggacccgcttcttcggggtcaggccggtcagcatc
ctgtaccgcctgtaccgtccgttgatctttgccctctattgtctcccgctcaactggctc
cgccggaagcacgggctgtcgagtctgggctgggatttgtgccgcattttcaccgacggt
gactacaccctgtatgccgacgtacccgagctggtgccgacatacaacctgccggccaac
catcgatatctcggacccgtcctgtggtcgcccgacgtaaaaccgccgacttggtggcac
tcgctgccgacagaccggccgattatttatgcgaccctcggcagttccggcggaaagaac
ctgttgcaggtggttttgaacgccctggccgatttacccgtcacggtgatcgcggccacc
gctggccggaaccacctgaagaacgtgccggccaacgccttcgtcgcggactacctgccg
ggcgaagcggctgcagcgcgctccgccgtggtgctctgcaacggcggcagcccgacgacg
cagcaggcgttggcggccggggtgccggtgatcgggctccccagcaacatggaccagcac
ttgaacatggaggcccttgagcgggccggcgccggcgttctcctgcgaaccgagcggctc
aacactgaaggcgtggcggcagccgtaaagcaggtgctcagtggggccgagttccgacaa
gccgcccggcggcttgccgaagccttcggaccagactttgccggattcccgcagcacatc
gaaagtgcgctgcggctcgtctgctaa

DBGET integrated database retrieval system