KEGG   Mycobacterium tuberculosis H37Rv: Rv2959cHelp
Entry
Rv2959c           CDS       T00015                                 

Definition
(RefSeq) rhamnosyl O-methyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3312101..3312838)
Genome map
AA seq 245 aa AA seqDB search
MGLVWRSRTSLVGQLIGLVRLVASFAAQLFYRPSDAVAEEYHKWYYGNLVWTKTTYMGIN
CWKSVSDMWNYQEILSELQPSLVIEFGTRYGGSAVYFANIMRQIGQPFKVLTVDNSHKAL
DPRARREPDVLFVESSSTDPAIAEQIQRLKNEYPGKIFAILDSDHSMNHVLAEMKLLRPL
LSAGDYLVVEDSNINGHPVLPGFGPGPYEAIEAYEDEFPNDYKHDAERENKFGWTSAPNG
FLIRN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggggctagtgtggcgcagtcggactagtcttgtagggcaactgatcggactagtcagg
ttagtggcgagttttgcggcccagttattctaccggccgagcgacgcagtggcggaagaa
taccacaagtggtactacggcaacttagtgtggacgaagaccacttatatggggatcaat
tgctggaaatccgtcagcgatatgtggaattaccaggagatcctgagcgagttgcaacca
tccctcgtcatcgagttcggcacccgctacggcggctcggcggtgtattttgccaacatc
atgaggcagatcggccagccattcaaggtacttaccgtggacaactcacacaaagccctc
gatccaagagcccggcgcgaaccagatgttttgttcgttgaatcgtcatccaccgacccg
gcgattgccgaacaaattcaacgcctcaaaaacgaataccctggcaagatcttcgccatc
ttagatagcgaccactcgatgaatcatgtgctggccgagatgaaattactacggccgcta
ctctccgccggtgactacctagtagtcgaggattccaacatcaacggccacccagtcctg
cccgggtttgggcctggaccctatgaagcgatcgaggcatatgaggatgaatttccaaac
gattacaagcatgatgcggagcgggagaacaaattcggctggacttccgcgcccaacgga
tttctgatccgcaactag

DBGET integrated database retrieval system