KEGG   Mycobacterium tuberculosis H37Rv: Rv2962cHelp
Entry
Rv2962c           CDS       T00015                                 

Definition
(RefSeq) PGL/p-HBAD biosynthesis rhamnosyltransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3313773..3315122)
Genome map
AA seq 449 aa AA seqDB search
MRVSCVYATASRWGGPPVASEVRGDAAISTTPDAAPGLAARRRRILFVAEAVTLAHVVRP
FALAQSLDPSRYEVHFACDPRYNQLLGPLPFRHHAIHTIPSERFFGNLTQGRFYAMRTLR
KYVEADLRVLDEIAPDLVVGDLRISLSVSARLAGIPYIAIANAYWSPYAQRRFPLPDVIW
TRLFGVRLVKLLYRLERPLLFALQCMPLNWVRRRHGLSSLGWNLCRIFTDGDHTLYADVP
ELMPTYDLPANHEYLGPVLWSPAGKPPTWWDSLPTDRPIVYATLGTSGGRNLLQLVLNAL
AELPVTVIAATAGRSDLKTVPANAFVADYLPGEAAAARSAVVVCNGGSLTTQQALVAGVP
VIGVAGNLDQHLNMEAVERAGAGVLLRTERLKSQRVAGAVMQVISRSEYRQAAARLADAF
GRDRVGFPQHVENALRLMPENRPRTWLAS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgtcgtgcgtgtacgctacggcgtcgaggtggggcgggccaccggttgctagc
gaggtgagaggggacgcggccatcagcacgacaccggacgccgcacctgggcttgccgca
cgcaggcgccggatccttttcgtcgcggaagcagtgaccctggctcacgtcgtccggcca
ttcgcgcttgcgcagtcgctggaccctagtcgttatgaagtgcacttcgcctgcgacccg
cgctacaaccagcttctaggtccgctccctttccgtcaccatgcgattcacaccatcccc
agcgagcggtttttcggcaatctgactcagggtcgtttctatgccatgcggacgctgcgg
aagtacgttgaggcggacctgcgggtcctggatgagatcgcgccggacctcgtcgtcggt
gaccttcgcatttcactgtcggtcagcgcccgactggccggcattccttacatcgcgatc
gcgaatgcctactggagtccgtacgcgcagcggcgttttccgctgcccgacgtgatatgg
acccgcttgttcggcgtcaggttggtcaagctcctctaccgcctggaacgccctttgctc
ttcgccctgcagtgcatgccgctcaactgggtccgccgcaggcacgggctgtcgagtctg
gggtggaacctgtgccgcattttcaccgacggggaccacaccctgtatgctgacgtgccc
gagctgatgcccacctacgacttgccggccaaccacgagtaccttggcccggtcctgtgg
tcgcccgccgggaagccgccgacatggtgggattcgctgccaaccgaccggccgatcgtg
tacgcaaccctgggcacgtccggcgggagaaatctgttgcaactggtgttgaacgcgttg
gctgagttgccggtgacggtgatcgcggccaccgcgggccgcagtgacctgaagaccgtg
ccggccaacgccttcgtggcggactacctgccgggtgaggccgctgcggctcgctcggcc
gtggtggtctgcaatggcgggagtttgacgacccagcaggccttggtggccggggtgccg
gtgatcggggtcgcgggcaatctcgatcagcacttgaatatggaggccgttgagcgggcc
ggggcgggcgtgctgctgcgaactgagcggctgaagagtcagcgggtggcaggggccgtg
atgcaggtgatcagtcggtccgagtaccgacaagccgccgcgcgactcgccgatgccttc
ggacgagaccgcgttggattcccgcagcatgtggagaatgctctgcgcctcatgccggag
aaccggccccggacatggttggccagctag

DBGET integrated database retrieval system