KEGG   Mycobacterium tuberculosis H37Rv: Rv2965cHelp
Entry
Rv2965c           CDS       T00015                                 

Gene name
kdtB
Definition
(RefSeq) phosphopantetheine adenylyltransferase
  KO
K00954  
pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv2965c (kdtB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Rv2965c (kdtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3318330..3318815)
Genome map
AA seq 161 aa AA seqDB search
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTH
LPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAP
RYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgcggtatgcccagggtcatttgacccggtgacgttaggccacgtcgacatt
ttcgaacgcgccgcagcccaattcgacgaggtggtggttgccatcctggtcaaccctgca
aagacgggcatgttcgacctcgacgagcggatcgcgatggtcaaggagtcgacaacgcac
ctgcccaatctgcgcgtgcaggtcgggcatggcttggtggtcgactttgtcaggtcttgc
gggatgaccgcgatcgtgaaggggctgcgcaccggcaccgacttcgaatacgagctgcag
atggcgcaaatgaacaaacacattgccggtgtggacacctttttcgtcgcgaccgcgcca
cggtattcgttcgtgtcgtcctcactggccaaagaagtcgcgatgctgggcggtgacgtg
tccgagttgctgcccgaaccggtgaatcgccggctgcgggacaggctcaacaccgaacgg
acctag

DBGET integrated database retrieval system