KEGG   Mycobacterium tuberculosis H37Rv: Rv2982cHelp
Entry
Rv2982c           CDS       T00015                                 

Gene name
gpdA2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00564  Glycerophospholipid metabolism
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv2982c (gpdA2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     Rv2982c (gpdA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C ApbA F420_oxidored NAD_binding_2 3HCDH_N 2-Hacid_dh_C Pyr_redox XdhC_C IlvN NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 887864
NCBI-ProteinID: NP_217498
TubercuList: Rv2982c
UniProt: P9WN77 I6YAS7
Position
complement(3337995..3338999)
Genome map
AA seq 334 aa AA seqDB search
MAGIASTVAVMGAGAWGTALAKVLADAGGEVTLWARRAEVADQINTTRYNPDYLPGALLP
PSIHATADAEEALGGASTVLLGVPAQTMRANLERWAPLLPEGATLVSLAKGIELGTLMRM
SQVIISVTGAEPPQVAVISGPNLASEIAECQPAATVVACSDSGRAVALQRALNSGYFRPY
TNADVVGTEIGGACKNIIALACGMAVGIGLGENTAAAIITRGLAEIIRLGTALGANGATL
AGLAGVGDLVATCTSPRSRNRSFGERLGRGETLQSAGKACHVVEGVTSCESVLALASSYD
VEMPLTDAVHRVCHKGLSVDEAITLLLGRRTKPE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccggaatagcaagcaccgtcgcggtgatgggcgccggtgcatggggcacggccctg
gctaaggtgctggccgacgcgggcggagaggtcacgctgtgggcgcggcgagctgaggtg
gccgatcagatcaataccacccgatataaccccgactatctgcccggtgcgctgttacca
ccgagcattcatgccaccgcagatgccgaggaggcacttgggggcgcatccacggtgctg
ttgggagtgcccgcgcagaccatgcgggccaatctcgagcggtgggctcccctgttgccc
gagggtgcgaccttggtcagtctggccaagggcatcgagttgggcaccctgatgcggatg
agccaggtcatcatctcggtgaccggtgccgagccgccgcaggtcgcggtgatctctgga
cccaacctggccagcgagatcgccgaatgccagcccgccgctaccgtcgtcgcgtgcagc
gactccggccgcgcggttgccttgcagcgcgcgctgaacagcgggtacttccgcccctac
accaacgccgatgtcgtcggcaccgagatcggcggggcgtgcaagaacatcatcgcgctt
gcgtgcggaatggcggtgggcatcgggctgggcgaaaacaccgcggccgcgatcatcacc
cggggcctggcggagatcatccggctcgggacggcgctcggcgccaacggcgcgacgttg
gccggtctggcaggggtcggtgatctggtggccacctgcacctcaccgcgttcgcgcaac
cgatcgtttggcgaacgcctgggccggggcgaaacgttgcagtcggcgggcaaggcttgt
catgtcgtcgaaggcgtgacgtcgtgcgaatccgtgctcgcgctggcgtccagctacgac
gtcgaaatgccactcaccgacgcggtgcatcgggtctgtcataaagggctgtcggtggac
gaggcgataacgctgctgctgggtcgccgcaccaagcccgaatga

DBGET integrated database retrieval system