KEGG   Mycobacterium tuberculosis H37Rv: Rv2984Help
Entry
Rv2984            CDS       T00015                                 

Gene name
ppk1
Definition
(RefSeq) polyphosphate kinase
  KO
K00937  
polyphosphate kinase [EC:2.7.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Oxidative phosphorylation
RNA degradation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv2984 (ppk1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rv2984 (ppk1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     Rv2984 (ppk1)
Messenger RNA biogenesis [BR:mtu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Rv2984 (ppk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
3339854..3342082
Genome map
AA seq 742 aa AA seqDB search
MMSNDRKVTEIENSPVTEVRPEEHAWYPDDSALAAPPAATPAAISDQLPSDRYLNRELSW
LDFNARVLALAADKSMPLLERAKFLAIFASNLDEFYMVRVAGLKRRDEMGLSVRSADGLT
PREQLGRIGEQTQQLASRHARVFLDSVLPALGEEGIYIVTWADLDQAERDRLSTYFNEQV
FPVLTPLAVDPAHPFPFVSGLSLNLAVTVRQPEDGTQHFARVKVPDNVDRFVELAAREAS
EEAAGTEGRTALRFLPMEELIAAFLPVLFPGMEIVEHHAFRITRNADFEVEEDRDEDLLQ
ALERELARRRFGSPVRLEIADDMTESMLELLLRELDVHPGDVIEVPGLLDLSSLWQIYAV
DRPTLKDRTFVPATHPAFAERETPKSIFATLREGDVLVHHPYDSFSTSVQRFIEQAAADP
NVLAIKQTLYRTSGDSPIVRALIDAAEAGKQVVALVEIKARFDEQANIAWARALEQAGVH
VAYGLVGLKTHCKTALVVRREGPTIRRYCHVGTGNYNSKTARLYEDVGLLTAAPDIGADL
TDLFNSLTGYSRKLSYRNLLVAPHGIRAGIIDRVEREVAAHRAEGAHNGKGRIRLKMNAL
VDEQVIDALYRASRAGVRIEVVVRGICALRPGAQGISENIIVRSILGRFLEHSRILHFRA
IDEFWIGSADMMHRNLDRRVEVMAQVKNPRLTAQLDELFESALDPCTRCWELGPDGQWTA
SPQEGHSVRDHQESLMERHRSP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaatgatcgcaaggtgaccgaaatcgaaaacagtcccgtcacagaggtgcgg
ccagaggagcatgcgtggtatccagacgactcggcgctggcggcaccgcccgctgccacc
cccgccgcgattagcgaccagctaccctcggatcgctacctgaaccgggagctgagttgg
ctggacttcaacgcgcgcgtgcttgccctggccgccgataagtcgatgccattgctcgag
cgcgccaagtttctggcaatcttcgcgtccaatctcgacgagttctacatggtccgggtg
gccggcctcaaacgccgcgacgagatggggttgtcggtgcgctccgccgacggtctaaca
ccgcgcgaacaactaggccggatcggcgagcagactcaacagctcgccagccggcatgcc
cgggtgttcctcgattcggtgctacccgcgctcggcgaggaaggcatctacatcgtcacc
tgggccgatttggatcaggctgagcgcgaccgattgtcgacctatttcaacgaacaggtc
ttccccgtcctgaccccgctggccgtcgatcccgcccacccgttcccgtttgtcagcggg
ttgagcttgaacctggcggtcacggtacgccaacctgaagacggcacccagcatttcgcg
agggtcaaggtgcccgacaacgtcgaccgcttcgtcgaactcgctgcacgtgaggccagc
gaggaagctgcggggaccgaaggccggaccgcgctgcggttcctgccgatggaggagctg
atcgcggccttccttccggtgcttttcccgggtatggaaatcgtcgagcaccacgcattt
cgcatcactcgcaacgctgacttcgaggttgaagaggatcgcgacgaggacctactgcag
gcgctcgagcgagaactggcccgccgccggttcggttcaccggtgcgactcgagatcgca
gacgacatgaccgagagcatgctggagttgctgcttcgcgaactcgacgtgcatcccggt
gatgtcatcgaagtgcccgggctgctcgacctatcgtcgttgtggcagatctacgccgtg
gaccgcccgacgcttaaggatcggacattcgtcccagctacccatcccgccttcgccgag
cgggaaacacccaaaagcatcttcgcgacgctgcgcgaaggcgatgtgctggttcaccat
ccgtatgactcgttctccaccagcgtgcagcgattcatcgaacaggccgcggccgacccc
aacgtgctggcgatcaaacagacgctgtaccgcacctccggcgactcgccgatcgtccgg
gcgctgatcgacgccgccgaagccggaaagcaagtggtggcactggtcgagatcaaggca
cgcttcgacgaacaggccaacatcgcctgggcgcgcgcactagaacaagccggcgtgcat
gtggcgtacgggctcgtcgggctcaagacgcactgcaagaccgccttggtggtgcgccgc
gaaggtccgacaatccggcggtactgccatgtcggcaccggcaattacaacagcaagaca
gcacgactctacgaggacgtcggactgctgaccgctgcacccgatatcggcgccgacttg
accgacttgttcaattcgctcaccggctactcacgcaagttgtcctaccgcaacttgttg
gtggccccgcacggaatccgcgccggcatcattgaccgcgtcgagcgggaggtcgcggcg
caccgtgcagagggtgcccacaacggcaaaggccgcatccgactcaagatgaatgccctt
gttgatgagcaggtcatcgatgcgctgtaccgcgcgtcgcgagccggtgtgcggatcgag
gtggtggtacgcggcatctgcgcgctgcgtccaggtgcgcagggcatttcggaaaacatc
atcgtgcgctcgattctcggccgcttcctcgagcactcgcggatcctccatttccgtgcc
atcgacgagttctggatcggcagcgccgacatgatgcaccgcaacctcgaccggcgagtc
gaggttatggctcaagtcaaaaacccgaggctgaccgcgcagctggacgaattgttcgaa
tccgcactggacccgtgcacccggtgctgggagctcgggcccgacgggcagtggaccgcg
tcgccgcaagaaggccatagcgtgcgcgaccatcaggaatcgctgatggaacggcaccgc
agcccctga

DBGET integrated database retrieval system