KEGG   Mycobacterium tuberculosis H37Rv: Rv2996cHelp
Entry
Rv2996c           CDS       T00015                                 

Gene name
serA1
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv2996c (serA1)
   01230 Biosynthesis of amino acids
    Rv2996c (serA1)
  Energy metabolism
   00680 Methane metabolism
    Rv2996c (serA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv2996c (serA1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Rv2996c (serA1)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv2996c (serA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3353483..3355069)
Genome map
AA seq 528 aa AA seqDB search
MSLPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVL
AAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAA
DASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAA
QLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAA
LADAITGGHVRAAGLDVFATEPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVR
LALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEE
VEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEICKASESPNHRSVVDVRAVGAD
GSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVN
IQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDLS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgcctgttgtgttgatcgccgacaaacttgccccatcaacggttgccgccttg
ggagatcaggtcgaggtgcgctgggttgacggtccggaccgagacaagctgctggccgcg
gtgcccgaagcggacgcgctgctggtgcgatcggccaccacggttgacgccgaggtgctg
gccgccgcccccaagctcaagatcgtcgcgcgcgccggcgtcgggctggacaacgtcgac
gtggacgccgcgacggcccgcggcgtgctggtggtcaacgccccgacgtcgaacatccac
agcgccgcggagcatgcgctggcgctgctgctggccgcctcacgccagattccggcggcc
gacgcgtcgctgcgcgagcacacctggaagcgttcgtcgttttccggtaccgagatcttc
ggcaaaaccgtcggcgtggtgggtctgggccgcatcgggcagttggtcgcccagcggatc
gctgcgttcggcgcttacgtcgtcgcctatgacccgtacgtttcgccggcccgtgcggcg
cagctgggcatcgaactgctgtccctggacgacctgctggcccgcgccgatttcatctcg
gtgcacctaccgaaaacaccggagacggcgggactgatcgacaaggaggcgctggcgaag
accaagccgggcgtcatcatcgtcaacgccgcgcgcggcggcctggtggacgaggcggca
ctggccgacgcgatcaccggcggccacgtgcgggcggccggtctggacgtgttcgccacc
gaaccgtgcaccgacagcccgctgttcgagctggcacaggtggtggtcacaccgcatctg
ggtgcgtccaccgcggaggcgcaggaccgggcgggcaccgacgtcgccgagagcgtgcgg
ctggccctggcaggggaattcgtgcccgacgcggtcaacgtcggcggcggagtggtcaac
gaggaggtggcgccctggctggatctggtgcgtaagctcggcgtgctggcgggtgtgttg
tccgacgaactgccggtgtcgttgtcggtgcaggtgcgcggtgagctggccgccgaagag
gttgaggtgctgcgcctttcggcgctgcgcggcctgttctcggcggtgatcgaggatgcg
gtgacatttgtcaacgcaccggcattggccgccgaacgtggcgtcaccgccgagatctgt
aaggcctcggaaagccccaaccaccgcagcgtcgtcgacgttcgcgcggtcggcgcggac
ggttcggtggtgaccgtctcgggcacgctgtatggcccacagctgtcgcagaagatcgtg
cagatcaacggccgccactttgatctgcgcgcccaggggatcaacctgatcatccactac
gtcgaccggccgggagcgctgggcaagatcggcacgttgctggggacggccggggtgaat
atccaggccgcgcagctctccgaagacgccgaaggcccgggcgcgacgattctgctgcgg
ctggaccaagacgtgcccgacgacgtgcggacggcgatcgcggcggcggtggacgcctac
aagctcgaggttgtcgatctgtcgtga

DBGET integrated database retrieval system