KEGG   Mycobacterium tuberculosis H37Rv: Rv3025cHelp
Entry
Rv3025c           CDS       T00015                                 

Gene name
iscS
Definition
(RefSeq) cysteine desulfurase
  KO
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv3025c (iscS)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Rv3025c (iscS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Rv3025c (iscS)
Transfer RNA biogenesis [BR:mtu03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Rv3025c (iscS)
 Prokaryotic Type
    Rv3025c (iscS)
Prokaryotic defense system [BR:mtu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Rv3025c (iscS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3383885..3385066)
Genome map
AA seq 393 aa AA seqDB search
MAYLDHAATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEARELIADKLGARPS
EVIFTAGGTESDNLAVKGIYWARRDAEPHRRRIVTTEVEHHAVLDSVNWLVEHEGAHVTW
LPTAADGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDA
IQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRDVTCVPLMHGGGQERDIRSGT
PDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLAEIDDVCLNGADDPMRLAGNA
HFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLIAMGVDAASARGSLRLSLGH
TSVEADVDAALEVLPGAVARARRAALAAAGASR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcctacctggatcacgctgccaccaccccgatgcaccccgccgccatcgaggcgatg
gcggccgtgcagcgcaccatcggcaatgcgtcgtcgctgcacaccagcgggcgctcggcg
cgccggcggatcgaggaggcccgtgagctgatcgcggacaagctaggcgctcgtccgtcc
gaggtgatcttcaccgcgggcggcaccgaaagcgacaacctggctgtcaaaggtatctat
tgggcacgccgcgatgcggagccgcaccgccgtcgcatcgtcaccaccgaggtggaacac
cacgccgtactggactcggtgaactggctcgtggaacacgaaggcgcccatgtgacctgg
ctgccgaccgccgccgacggctcggtgtcggcaactgcgctgcgcgaggcactgcagagc
cacgacgacgtcgcgctggtatcggtgatgtgggccaacaacgaggtcggaactattcta
ccgatcgccgaaatgtcagttgtcgccatggaattcggcgtgccgatgcacagtgatgcc
attcaggcggtgggacagctcccgcttgacttcggggccagcgggctgtcggcgatgagc
gtggccgggcacaaattcggtggcccgccaggagtgggtgcgttgctgctgcgccgcgac
gtcacctgcgtgccccttatgcacggcggtgggcaggagcgcgatattcgttccggcaca
cccgatgtcgccagtgcagttggaatggcgacggccgcgcagatcgcggtggacggactc
gaggaaaacagcgcgcggttacggctgctgcgggatcgtctggtcgagggtgtgctggct
gagattgacgatgtttgccttaacggcgccgatgacccgatgcggctagcgggtaacgcg
cacttcactttccgtggctgcgaaggcgatgcgctgttgatgttgttggacgctaacgga
atcgagtgctcaaccggatcggcctgcacggcaggtgtagcgcagccctcgcatgtgttg
attgcaatgggcgtcgacgcggccagcgcccgcggatcattgcgtctctcgctggggcac
accagtgttgaggctgatgtcgatgccgcgttggaggtgcttcccggggcggtggcacgt
gcacggcgggccgccctagccgccgcgggagcatcccgatga

DBGET integrated database retrieval system