KEGG   Mycobacterium tuberculosis H37Rv: Rv3042cHelp
Entry
Rv3042c           CDS       T00015                                 

Gene name
serB2
Definition
(RefSeq) phosphoserine phosphatase SerB
  KO
K01079  
phosphoserine phosphatase [EC:3.1.3.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv3042c (serB2)
   01230 Biosynthesis of amino acids
    Rv3042c (serB2)
  Energy metabolism
   00680 Methane metabolism
    Rv3042c (serB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3042c (serB2)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     Rv3042c (serB2)
Protein phosphatases and associated proteins [BR:mtu01009]
 HAD phosphatases
  Other HAD phosphatases
   Rv3042c (serB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3401933..3403162)
Genome map
AA seq 409 aa AA seqDB search
MPAKVSVLITVTGMDQPGVTSALFEVLAQHGVELLNVEQVVIRGRLTLGVLVSCPLDVAD
GTALRDDVAAAIHGVGLDVAIERSDDLPIIRQPSTHTIFVLGRPITAGAFSAVARGVAAL
GVNIDFIRGISDYPVTGLELRVSVPPGCVGPLQIALTKVAAEEHVDVAVEDYGLAWRTKR
LIVFDVDSTLVQGEVIEMLAARAGAQGQVAAITEAAMRGELDFAESLQRRVATLAGLPAT
VIDDVAEQLELMPGARTTIRTLRRLGFRCGVVSGGFRRIIEPLARELMLDFVASNELEIV
DGILTGRVVGPIVDRPGKAKALRDFASQYGVPMEQTVAVGDGANDIDMLGAAGLGIAFNA
KPALREVADASLSHPYLDTVLFLLGVTRGEIEAADAGDCGVRRVEIPAD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggtgtcggtgctgatcacggtcaccggcatggatcagccaggcgtgaca
tccgcgctcttcgaggtgctcgcgcagcacggagtcgagctgctcaacgtcgaacaagtg
gtgatccggggccggctcacgctgggtgtgctggtgtcgtgcccgctggacgttgccgac
ggtaccgcgctgcgcgacgacgtcgcggccgccatccacggggtgggtctagacgtcgcc
atcgagcgcagcgacgatctgccaatcattcggcaaccgtccacccacaccattttcgtg
ctgggacgcccgattaccgccggagcgttcagcgcggtggccaggggagtggccgcactc
ggcgtcaacatcgacttcatccgcggcatttccgactacccggtcaccggcctggagttg
cgggtctcggtgccgcctggatgcgtgggtccgctgcagatcgccctgaccaaggtggcc
gccgaagagcatgtcgatgtggccgtcgaggactacggcttggcttggcgcaccaaacgc
ctgatcgtcttcgacgtcgactccactctggtccaaggcgaggtcatcgagatgctggca
gcccgtgcgggtgcccagggacaggtcgccgcgatcaccgaggccgcgatgcgtggtgag
ctggacttcgccgagtcgctgcagcgtcgtgttgccaccttggcggggctgcccgcgacg
gtgatagacgacgtcgccgagcagctcgaactgatgcccggtgctcggaccacgatccgg
accttgcggcgtctgggttttcgctgcggtgtggtttccggcggctttcggcggatcatc
gagccgctcgcacgcgagttgatgttggatttcgttgcgtccaacgagctggaaatcgtc
gatggcattcttaccggccgggtcgtggggccgattgttgaccggcccggcaaggccaag
gcgcttcgggacttcgcgagccagtatggggtgccgatggagcagaccgtcgcggtcggc
gacggcgccaacgatatcgacatgctgggcgcggccgggctgggaatagcattcaacgcc
aagccggcgttgcgtgaggtcgccgatgcgtcgttgagccatccgtacctggacacggtg
ttgttcttgttgggcgtgactcgcggtgagatcgaggccgccgacgccggcgactgtggg
gtgcgtcgcgtcgaaatcccggccgactag

DBGET integrated database retrieval system