KEGG   Mycobacterium tuberculosis H37Rv: Rv3051cHelp
Entry
Rv3051c           CDS       T00015                                 

Gene name
nrdE
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  
ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv3051c (nrdE)
   00240 Pyrimidine metabolism
    Rv3051c (nrdE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     Rv3051c (nrdE)
DNA repair and recombination proteins [BR:mtu03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Rv3051c (nrdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3412085..3414166)
Genome map
AA seq 693 aa AA seqDB search
MLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYS
RNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGD
TALAELLVDEIIDGRFQPATPTFLNSGKKQRGEPVSCFLLRVEDNMESIGRSINSALQLS
KRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHA
HHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVP
FADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRANPIDGK
ITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLNIAKTMDSPDFAQTIEVAIRA
LTAVSDQTHIKSVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSDEGIDFTNIYFYTV
LYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYTDQIWEPKTQKVRQLFADAGIRIP
TQDDWRRLKESVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVY
YPAPYMTNDNLEYYEDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQI
YAWRKGIKTLYYIRLRQMALEGTEVEGCVSCML
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacctgtacgacgcggacggcaagatccagttcgacaaggatcgggaagcagcc
caccagtactttttgcagcatgtcaatcagaacacggtcttcttccataatcaggacgag
aagctcgactacctgatccgcgagaattactacgagcgtgaggttctcgaccagtactcg
cgcaacttcgtcaagacgctgctagaccgcgcctacgccaaaaagttccggtttccgacg
tttttgggtgcgttcaagtactacacctcctacacgctgaaaacctttgacgggaagcgc
tatctggagcgcttcgaggaccgcgtggtcatggtggcgctaacgttggccgccggcgat
accgcacttgccgagctgctggtcgacgagatcatcgacggccgcttccagcccgccaca
ccgacgtttttgaattctggcaagaagcagcgcggggagcccgtgagctgttttttgctt
cgcgtcgaagacaacatggagtcgatcggacggtcgatcaactccgcgctgcagctatcc
aagcgtggcgggggagtggcgttgctgctgaccaacattcgcgagcacggcgcgccgatc
aagaacatcgagaaccagtcctcgggcgtcatccccatcatgaagttgctggaggatgcg
ttctcctacgccaaccagctgggcgctcgtcaaggtgccggcgcggtgtacctgcacgcc
catcaccccgacatctaccgattcctggacaccaagcgtgagaacgccgacgagaagatc
cggatcaagacgctgagtctgggggtggtgatccccgacatcaccttcgagttggccaag
cgcaacgatgacatgtacctgttctcgccctacgatgtcgagcgggtctacggtgtgccg
ttcgctgacatctcggtcaccgagaagtactacgaaatggtcgatgacgcgcgcatccgc
aagaccaagatcaaggcacgggagttcttccagacgctggccgagctgcagttcgagtcc
ggctacccctatatcatgttcgaagacaccgtcaatcgcgctaatccaattgatggcaag
atcacgcacagcaacctgtgctcggagatcctgcaagtgtctacgccgtcattgttcaac
gaggacttgtcgtatgccaaagtgggcaaagacatttcgtgcaacctggggtcgctgaac
atcgccaagacgatggactcgccggacttcgcgcagacgatcgaggtggcgatccgcgcg
ttgaccgcggtgagcgaccaaacccatatcaagtcggtgccctcaatcgagcagggcaac
aacgactcccacgcgatcgggctaggacagatgaacctgcacggctacctggcccgggaa
cgcatcttctacggatccgacgaaggcatcgacttcaccaacatctacttctatacggtg
ctgtatcacgcgttgcgggcatccaaccgcatcgcgatcgaacgcggcacgcacttcaag
ggtttcgagcggtccaagtacgcgtccggggaattcttcgacaagtacaccgaccagatt
tgggagccgaagacccagaaggtacgccagctgttcgccgacgccggcatccgcatccca
acgcaggacgactggcgtcggctcaaggagtcggtgcaagcgcacggcatctacaaccag
aacctgcaggcggtgccgccgaccgggtcgatttcctacatcaaccattcgacgtcgtcg
attcacccgatcgtgtcgaaggtcgagatccgcaaggaaggcaagatcgggcgggtctac
tacccggcgccgtatatgaccaacgacaacctggagtactacgaagacgcctacgagatc
ggttacgagaagatcatcgacacctacgcggcggccacccagcatgtggatcaagggctt
tcgctgacgttgttcttcaaagacaccgccaccacccgcgacgtgaacaaggcgcagatt
tacgcctggcgcaaggggatcaagacgctgtactacatccggctgcggcagatggcgttg
gagggcaccgaggtcgagggttgcgtgtcctgcatgctgtag

DBGET integrated database retrieval system