KEGG   Mycobacterium tuberculosis H37Rv: Rv3068cHelp
Entry
Rv3068c           CDS       T00015                                 

Gene name
pgmA
Definition
(RefSeq) phosphoglucomutase PgmA
  KO
K01835  
phosphoglucomutase [EC:5.4.2.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv3068c (pgmA)
   00030 Pentose phosphate pathway
    Rv3068c (pgmA)
   00052 Galactose metabolism
    Rv3068c (pgmA)
   00500 Starch and sucrose metabolism
    Rv3068c (pgmA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3068c (pgmA)
  Nucleotide metabolism
   00230 Purine metabolism
    Rv3068c (pgmA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv3068c (pgmA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rv3068c (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3431979..3433622)
Genome map
AA seq 547 aa AA seqDB search
MVANPRAGQPAQPEDLVDLPHLVTAYYSIEPDPDDLAQQVAFGTSGHRGSALTGTFNELH
ILAITQAIVEYRAAQGTTGPLFIGRDTHGLSEPAWVSALEVLAANQVVAVVDSRDRYTPT
PAISHAILTYNRGRTEALADGIVVTPSHNPPSDGGIKYNPPNGGPADTAATTAIAKRANE
ILLARSMVKRLPLARALRTAQRHDYLGHYVDDLPNVVDIAAIREAGVRIGADPLGGASVD
YWGEIAHRHGLDLTVVNPLVDATWRFMTLDTDGKIRMDCSSPDAMAGLIRTMFGNRERYQ
IATGNDADADRHGIVTPDEGLLNPNHYLAVAIEYLYTHRPSWPAGIAVGKTVVSSSIIDR
VVAGIGRQLVEVPVGFKWFVDGLIGATLGFGGEESAGASFLRRDGSVWTTDKDGIIMALL
AAEILAVTGATPSQRYHALAGEYGGPCYARIDAPADREQKARLARLSADQVSATELAGEP
ITAKLTTAPGNGAALGGLKVTTANAWFAARPSGTEDVYKIYAESFRGPQHLVEVQQTARE
VVDRVIG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaacccacgagccggtcaaccggcccagcccgaagacctcgtcgacctgccc
catctggtgactgcgtactactcgatcgaacccgatcccgacgacctcgctcaacaggtc
gctttcggcacctcagggcaccggggctcagccctgaccggaacgttcaacgaactacat
attctggccatcacccaggctatcgtcgaataccgcgccgcccaggggaccaccgggccg
ctgttcatcggccgtgacacccatggcctttcggaaccggcatgggtatcggcgctggag
gtactcgccgccaatcaggtggtggccgtcgtcgactcccgcgaccgctacacgccgacg
ccggcaatcagccacgccatcttgacctacaaccgcggccggaccgaagcgctggccgac
gggatcgttgtgacgccgtcgcacaacccgccgtccgacggcggcatcaagtacaaccca
cccaacggtggcccggcggacaccgctgcgaccaccgcaatagccaagcgtgccaacgag
attctgctcgctcggtcgatggtgaagcggttgccgctggcccgcgcgttacgcaccgcc
cagcgacacgactacctgggccactatgtcgatgacctgccgaacgtggtcgatatcgcc
gccattcgcgaggccggggtgcggatcggcgccgacccgctcggcggggccagcgtggat
tactggggtgagatcgcccaccggcatggcctagacctgaccgtggtcaatccgctggtc
gacgcaacctggcggttcatgaccctggacaccgacgggaagatccggatggactgcagt
tcaccggatgcgatggctgggctcatccgaacgatgttcggcaaccgggagcgctaccag
atcgccaccggcaacgacgccgacgccgaccgacacggcatagtcacccctgacgaaggg
ctgctgaatcctaaccactatctggccgtggccatcgaatatctctacacccaccgcccg
tcctggccggccggcatcgccgtgggcaagacggtggtcagctcgtcgatcatcgaccgg
gtggtcgccgggatcggccgtcaactcgttgaggtaccggtcggattcaaatggttcgtc
gacggtctgatcggcgccaccttgggcttcggcggcgaggaatcggcgggggcatcattt
ctgcgacgggacggatcggtatggaccaccgacaaggacggcatcatcatggcgctgctg
gccgccgagatcctggcggtcaccggggctacgccgtcgcagcgatatcacgcgctggcc
ggcgagtacggtgggccgtgctatgcgcggatcgacgcgcccgccgatcgggagcagaaa
gcccgcctggccaggctgtcggccgaccaggtgagcgccaccgagttggccggtgagccg
atcaccgcaaagctgacgaccgcgcccggcaacggtgctgcgctgggcggattgaaggtg
acgacggccaatgcgtggtttgccgcgcgtccgtcgggcaccgaggacgtctacaagatc
tacgcggagtccttccgtggaccgcaacatctggtcgaggtgcagcagaccgcccgcgaa
gtggtcgatcgggtcatcgggtga

DBGET integrated database retrieval system