KEGG   Mycobacterium tuberculosis H37Rv: Rv3075cHelp
Entry
Rv3075c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K01644  
citrate lyase subunit beta / citryl-CoA lyase [EC:4.1.3.34]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rv3075c
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     Rv3075c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3438050..3438973)
Genome map
AA seq 307 aa AA seqDB search
MTSMYEQVDTNTADPVAGSRIDPVLARSWLLVNGAHGDRFESAAHSRADIVVLDIEDAVA
PKDKHAARDNAVRWFGDGNADWVRINGFGTPWWADDLAMLADSPVGGVMLAMVESVDHVT
ETAKRLPNVPIVALVETARGLERINEIAAAKGTFRLAFGIGDFRRDTGFGEDPATLAYAR
SRFTIAARAAGLPSAIDGPTIGSNALKLIEATAVSAEFGMTGKICLSPDQCPVVNEGLSP
SQDEIVWAKEFFAEFARDGGEIRNGSDLPRIARATKILDLARAYGIEVSDFEDEPVHMPA
PTDTYHY
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaatgtatgaacaggtcgataccaacacggcggatccggtggccgggtctcgt
atcgatccggttctcgcgcggagttggttactggtcaacggcgcgcacggcgaccggttc
gagtccgccgcgcactcacgcgccgacatcgtcgtgctcgatatcgaggacgcggtcgct
cccaaagacaagcatgccgcccgggacaacgccgtgcgttggtttggtgacggaaacgct
gactgggtgcgcatcaacggcttcggcacaccttggtgggcggacgatctagcgatgttg
gccgatagccccgttggcggagtgatgctggcgatggtcgaatcggtggaccatgtcacc
gagaccgcgaaacgactacctaacgtgccgatcgttgcactggtcgaaacggcgcggggt
ctggagcgcatcaacgagattgctgcggccaagggcaccttccggctcgccttcggtatc
ggcgactttcgccgggacaccggctttggcgaagacccggcaacattggcctacgcgcgg
tcgcgctttaccatcgcggcccgggccgccggtctgcccagcgcgatcgacgggccgacc
atcggctccaacgcgctcaagctgatcgaggccacggccgtctccgccgagtttggcatg
accggcaagatctgcctttcgccggaccaatgtccggtggtgaatgaggggctatccccg
tcgcaggacgaaatcgtctgggcgaaggaatttttcgctgagttcgcccgcgacgggggc
gagatccgcaacgggtctgacctgccgcgcattgcccgggccaccaagatcctcgatctg
gcccgcgcctacggcatcgaagtgtccgacttcgaggacgaaccggttcacatgccggct
ccgactgacacctaccactactag

DBGET integrated database retrieval system