KEGG   Mycobacterium tuberculosis H37Rv: Rv3097cHelp
Entry
Rv3097c           CDS       T00015                                 

Gene name
lipY
Definition
(RefSeq) triacylglycerol lipase Lip
  KO
K01046  
triacylglycerol lipase [EC:3.1.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rv3097c (lipY)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     Rv3097c (lipY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(3465778..3467091)
Genome map
AA seq 437 aa AA seqDB search
MVSYVVALPEVMSAAATDVASIGSVVATASQGVAGATTTVLAAAEDEVSAAIAALFSGHG
QDYQALSAQLAVFHERFVQALTGAAKGYAAAELANASLLQSEFASGIGNGFATIHQEIQR
APTALAAGFTQVPPFAAAQAGIFTGTPSGAAGFDIASLWPVKPLLSLSALETHFAIPNNP
LLALIASDIPPLSWFLGNSPPPLLNSLLGQTVQYTTYDGMSVVQITPAHPTGEYVVAIHG
GAFILPPSIFHWLNYSVTAYQTGATVQVPIYPLVQEGGTAGTVVPAMAGLISTQIAQHGV
SNVSVVGDSAGGNLALAAAQYMVSQGNPVPSSMVLLSPWLDVGTWQISQAWAGNLAVNDP
LVSPLYGSLNGLPPTYVYSGSLDPLAQQAVVLEHTAVVQGAPFSFVLAPWQIHDWILLTP
WGLLSWPQINQQLGIAA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtcttatgttgttgcgttgccggaggtgatgtccgccgcggccacagacgtggct
tcgattggttcggtggtcgcgacggcgagccagggtgtcgcgggtgccaccacgacggta
ttagccgctgccgaggacgaggtgtcagccgcgatcgcggctttgttttccggccatggt
caggactatcaagctcttagcgcacagcttgcggtgtttcatgagcggtttgtgcaggca
ttgacaggcgcggccaaggggtatgccgccgccgagctggccaacgcttcgctgttgcag
agtgaattcgccagcggtatcgggaacggttttgccacgattcaccaggaaattcagcgg
gcccccacggcgctggccgccggattcacgcaggttccgcctttcgcggcggcgcaggca
gggatcttcaccggcacgccgtcaggggctgccggattcgacatcgcttcgctgtggccg
gtgaaacccctgctgagtttgtctgcgctcgaaactcactttgcaatcccaaacaatcca
cttttagcgctcattgccagcgacataccgccgctgtcgtggtttcttggcaactcccca
ccgccgttgctgaactcgctgctgggacagacggtccagtacaccacctatgacgggatg
agcgtcgtgcagatcacgccggctcatccaaccggcgaatacgtggttgccattcacggc
ggcgcgtttatcctgccgccgtcaatcttccactggctcaactactcggtgacggcttac
cagaccggcgcgaccgtgcaagtgccgatttacccgttggtgcaggaaggaggcactgcc
gggacggtagtaccggcgatggccgggctcatctccacgcaaatcgcgcaacacggggtc
tccaacgtcagcgtggtcggggactccgcgggcggcaacctcgcactggcggccgcccaa
tacatggtgagccagggcaacccagtaccgtcgtccatggtgttgctgtccccgtggctc
gatgtggggacctggcagatcagccaggcgtgggcaggcaatcttgcggtcaacgacccg
ctggtcagtccgctgtatgggtcgctgaacggtcttccgccgacgtatgtctattcgggc
tcgcttgatccgctcgcacaacaagcggttgtcctcgagcacacagccgtagtccaagga
gcgccgttcagcttcgtactggccccctggcaaatccacgactggatactgctcaccccc
tggggtttgctgtcctggccgcagattaaccagcaactcggtatcgccgcctga

DBGET integrated database retrieval system